Property Summary

NCBI Gene PubMed Count 16
PubMed Score 206.47
PubTator Score 15.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Lung Neoplasms 232 0.0 0.0
Disease Target Count P-value
inflammatory breast cancer 286 1.3e-04
psoriasis 6694 2.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Schizophrenia 1160 0.0 1.2
Disease Target Count Z-score Confidence
Hypotrichosis 7 4 3.852 1.9
Listeriosis 18 3.051 1.5
Heart disease 306 3.047 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
inflammatory breast cancer -2.700 1.3e-04
psoriasis -1.200 2.3e-03

Gene RIF (9)

AA Sequence

MQWLMRFRTLWGIHKSFHNIHPAPSQLRCRSLSEFGAPRWNDYEVPEEFNFASYVLDYWAQKEKEGKRGP      1 - 70
NPAFWWVNGQGDEVKWSFREMGDLTRRVANVFTQTCGLQQGDHLALMLPRVPEWWLVAVGCMRTGIIFIP     71 - 140
ATILLKAKDILYRLQLSKAKGIVTIDALASEVDSIASQCPSLKTKLLVSDHSREGWLDFRSLVKSASPEH    141 - 210
TCVKSKTLDPMVIFFTSGTTGFPKMAKHSHGLALQPSFPGSRKLRSLKTSDVSWCLSDSGWIVATIWTLV    211 - 280
EPWTAGCTVFIHHLPQFDTKVIIQTLLKYPINHFWGVSSIYRMILQQDFTSIRFPALEHCYTGGEVVLPK    281 - 350
DQEEWKRRTGLLLYENYGQSETGLICATYWGMKIKPGFMGKATPPYDVQVIDDKGSILPPNTEGNIGIRI    351 - 420
KPVRPVSLFMCYEGDPEKTAKVECGDFYNTGDRGKMDEEGYICFLGRSDDIINASGYRIGPAEVESALVE    421 - 490
HPAVAESAVVGSPDPIRGEVVKAFIVLTPQFLSHDKDQLTKELQQHVKSVTAPYKYPRKVEFVSELPKTI    491 - 560
TGKIERKELRKKETGQM                                                         561 - 577
//

Text Mined References (18)

PMID Year Title