Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
medulloblastoma 1524 1.56048313763549E-5
osteosarcoma 7933 4.41660269001557E-5
non diabetic and post-ischemic heart failure 200 8.33045064785017E-4
spina bifida 1064 0.0423276091923021
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0


  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.819 0.000
medulloblastoma 1.300 0.000
non diabetic and post-ischemic heart fai... 1.200 0.001
spina bifida -1.342 0.042


Accession Q08AG5 Q5JPI8


AA Sequence

YTKGCTLERNHINVRIVGKHSVCLVPFVDIKGLTLE                                      631 - 666

Text Mined References (5)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.