Property Summary

NCBI Gene PubMed Count 60
Grant Count 16
R01 Count 11
Funding $919,596.81
PubMed Score 51.13
PubTator Score 60.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
ependymoma 1.600 0.002
oligodendroglioma 1.500 0.002
psoriasis -1.200 0.005
osteosarcoma -1.182 0.000
group 3 medulloblastoma 1.700 0.000
astrocytoma 1.400 0.004
glioblastoma 1.200 0.015
atypical teratoid/rhabdoid tumor 1.400 0.000
medulloblastoma, large-cell 1.800 0.000
primitive neuroectodermal tumor 1.200 0.000
acute quadriplegic myopathy 1.435 0.000
lung cancer 2.200 0.003
colon cancer 1.100 0.008
diabetes mellitus 2.400 0.001
pediatric high grade glioma 1.100 0.000
lung adenocarcinoma 1.237 0.000

Gene RIF (25)

PMID Text
26966247 AID accesses the H2B N-terminal basic region exposed by partial unwrapping of the nucleosomal DNA, thereby triggering the invasion of FACT into the nucleosome
26842758 FACT is required for TOP1 binding to H3K4me3 at non-B DNA containing chromatin for the site-specific cleavage.
26378236 shRNA knockdown of SSRP1 increases HIV-1 LTR-driven gene expression in HEK293 cells transduced with VSV-G pseudo-typed HIV-1 NL4-3-Luc construct; i.e. HIV-1 is restricted by SSRP1
25028470 FACT, NF-kappaB, and cell-cycle progression are inhibited by quinacrine, which overcomes resistance to erlotinib in non-small cell lung cancer
25000480 EEF1A1, SSRP1, and XRCC6 are novel interacting partners of the mineralocorticoid receptor
24357716 A primary role for FACT in RNF20 recruitment chromatin remodeling for initiation of homologous recombination repair.
23839038 In the absence of FACT complex, SSRP1 and SPT16 mRNAs are unstable and inefficiently translated, making reactivation of FACT function unlikely in normal cells.
23610384 hFACT-H2A/H2B interactions play a key role in overcoming the nucleosomal barrier by Pol II and promoting nucleosome survival during transcription
23325844 SETD2 activity modulates FACT recruitment and nucleosome dynamics, thereby repressing cryptic transcription initiation.
22940245 The HSF1-RPA complex leads to preloading of RNA polymerase II and opens the chromatin structure by recruiting a histone chaperone, FACT
More...

AA Sequence

MAETLEFNDVYQEVKGSMNDGRLRLSRQGIIFKNSKTGKVDNIQAGELTEGIWRRVALGHGLKLLTKNGH      1 - 70
VYKYDGFRESEFEKLSDFFKTHYRLELMEKDLCVKGWNWGTVKFGGQLLSFDIGDQPVFEIPLSNVSQCT     71 - 140
TGKNEVTLEFHQNDDAEVSLMEVRFYVPPTQEDGVDPVEAFAQNVLSKADVIQATGDAICIFRELQCLTP    141 - 210
RGRYDIRIYPTFLHLHGKTFDYKIPYTTVLRLFLLPHKDQRQMFFVISLDPPIKQGQTRYHFLILLFSKD    211 - 280
EDISLTLNMNEEEVEKRFEGRLTKNMSGSLYEMVSRVMKALVNRKITVPGNFQGHSGAQCITCSYKASSG    281 - 350
LLYPLERGFIYVHKPPVHIRFDEISFVNFARGTTTTRSFDFEIETKQGTQYTFSSIEREEYGKLFDFVNA    351 - 420
KKLNIKNRGLKEGMNPSYDEYADSDEDQHDAYLERMKEEGKIREENANDSSDDSGEETDESFNPGEEEED    421 - 490
VAEEFDSNASASSSSNEGDSDRDEKKRKQLKKAKMAKDRKSRKKPVEVKKGKDPNAPKRPMSAYMLWLNA    491 - 560
SREKIKSDHPGISITDLSKKAGEIWKGMSKEKKEEWDRKAEDARRDYEKAMKEYEGGRGESSKRDKSKKK    561 - 630
KKVKVKMEKKSTPSRGSSSKSSSRQLSESFKSKEFVSSDESSSGENKSKKKRRRSEDSEEEELASTPPSS    631 - 700
EDSASGSDE                                                                 701 - 709
//

Text Mined References (75)

PMID Year Title
27499292 2016 The Flexible Ends of CENP-A Nucleosome Are Required for Mitotic Fidelity.
26966247 2016 Integrated molecular mechanism directing nucleosome reorganization by human FACT.
26842758 2016 Chromatin remodeller SMARCA4 recruits topoisomerase 1 and suppresses transcription-associated genomic instability.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25028470 2014 Quinacrine overcomes resistance to erlotinib by inhibiting FACT, NF-?B, and cell-cycle progression in non-small cell lung cancer.
25000480 2014 Use of phage display to identify novel mineralocorticoid receptor-interacting proteins.
24357716 2014 Histone chaperone FACT regulates homologous recombination by chromatin remodeling through interaction with RNF20.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23839038 2013 Complex mutual regulation of facilitates chromatin transcription (FACT) subunits on both mRNA and protein levels in human cells.
23610384 2013 Histone chaperone FACT action during transcription through chromatin by RNA polymerase II.
More...