Property Summary

NCBI Gene PubMed Count 69
PubMed Score 55.44
PubTator Score 60.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
acute quadriplegic myopathy 1.435 4.0e-08
astrocytoma 1.400 4.5e-03
atypical teratoid / rhabdoid tumor 1.200 6.0e-06
colon cancer 1.100 7.5e-03
diabetes mellitus -1.100 2.3e-03
ependymoma 1.600 1.7e-03
glioblastoma 1.200 1.5e-02
group 3 medulloblastoma 1.700 1.0e-04
lung adenocarcinoma 1.237 2.4e-07
lung cancer 1.500 5.9e-04
malignant mesothelioma 1.100 2.3e-06
medulloblastoma, large-cell 1.800 1.4e-04
oligodendroglioma 1.500 1.7e-03
osteosarcoma -1.182 2.5e-04
pediatric high grade glioma 1.100 7.4e-05
primitive neuroectodermal tumor 1.200 3.7e-04
psoriasis -1.200 4.6e-03

Gene RIF (35)

AA Sequence

MAETLEFNDVYQEVKGSMNDGRLRLSRQGIIFKNSKTGKVDNIQAGELTEGIWRRVALGHGLKLLTKNGH      1 - 70
VYKYDGFRESEFEKLSDFFKTHYRLELMEKDLCVKGWNWGTVKFGGQLLSFDIGDQPVFEIPLSNVSQCT     71 - 140
TGKNEVTLEFHQNDDAEVSLMEVRFYVPPTQEDGVDPVEAFAQNVLSKADVIQATGDAICIFRELQCLTP    141 - 210
RGRYDIRIYPTFLHLHGKTFDYKIPYTTVLRLFLLPHKDQRQMFFVISLDPPIKQGQTRYHFLILLFSKD    211 - 280
EDISLTLNMNEEEVEKRFEGRLTKNMSGSLYEMVSRVMKALVNRKITVPGNFQGHSGAQCITCSYKASSG    281 - 350
LLYPLERGFIYVHKPPVHIRFDEISFVNFARGTTTTRSFDFEIETKQGTQYTFSSIEREEYGKLFDFVNA    351 - 420
KKLNIKNRGLKEGMNPSYDEYADSDEDQHDAYLERMKEEGKIREENANDSSDDSGEETDESFNPGEEEED    421 - 490
VAEEFDSNASASSSSNEGDSDRDEKKRKQLKKAKMAKDRKSRKKPVEVKKGKDPNAPKRPMSAYMLWLNA    491 - 560
SREKIKSDHPGISITDLSKKAGEIWKGMSKEKKEEWDRKAEDARRDYEKAMKEYEGGRGESSKRDKSKKK    561 - 630
KKVKVKMEKKSTPSRGSSSKSSSRQLSESFKSKEFVSSDESSSGENKSKKKRRRSEDSEEEELASTPPSS    631 - 700
EDSASGSDE                                                                 701 - 709
//

Text Mined References (85)

PMID Year Title