Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.93
PubTator Score 51.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
cystic fibrosis 1.600 8.2e-06
intraductal papillary-mucinous adenoma (... 1.200 1.0e-03
intraductal papillary-mucinous neoplasm ... 1.800 6.6e-03
psoriasis 1.100 4.2e-73

Gene RIF (1)

AA Sequence

MAAPPQPVTHLIFDMDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMS      1 - 70
KEELVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSGSASFDMKTSRHKEFFSLFSHIVLG     71 - 140
DDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLV    141 - 210
LNSLQDFQPELFGLPSYE                                                        211 - 228
//

Text Mined References (13)

PMID Year Title