Property Summary

NCBI Gene PubMed Count 36
Grant Count 9
R01 Count 9
Funding $1,500,953.01
PubMed Score 21.94
PubTator Score 44.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Gene RIF (6)

PMID Text
23975055 Low expression of DSC 1, 2, and 3 was observed in 55, 54, and 79 % of liver metastases.
23898208 HIV-1 Tat downregulates the expression of desmocollin 1 (DSC1) in human primary T cells
22438068 High expression of desmocollin 1 (DSC1) was observed in 41.6%, DSC2 in 58.0%, DSC3 in 61.4%, E-cadherin in 71.4%, CDX2 in 58.0%, PITX1 in 55.0%, CDK4 in 0.2%, TLE1 in 1.3%, Factor H in 42.5%, and MDM2 in 0.2% of colorectal carcinomas.
17088906 Increased Dsc1 protein is associated with colorectal cancer
16628198 in majority of patients with Netherton syndrome, Dsg1 & Dsc1 were reduced in living layers of epidermis; SCTE-like & SCCE-like activities were increased, suggesting these proteases participate in premature degradation of corneodesmosomal cadherins
15140019 The ultrastructural modifications of desmosomes during terminal differentiation of hair follicles are paralleled by the modulation of the synthesis of desmocollin 1.

AA Sequence

MALASAAPGSIFCKQLLFSLLVLTLLCDACQKVYLRVPSHLQAETLVGKVNLEECLKSASLIRSSDPAFR      1 - 70
ILEDGSIYTTHDLILSSERKSFSIFLSDGQRREQQEIKVVLSARENKSPKKRHTKDTALKRSKRRWAPIP     71 - 140
ASLMENSLGPFPQHVQQIQSDAAQNYTIFYSISGPGVDKEPFNLFYIEKDTGDIFCTRSIDREKYEQFAL    141 - 210
YGYATTADGYAPEYPLPLIIKIEDDNDNAPYFEHRVTIFTVPENCRSGTSVGKVTATDLDEPDTLHTRLK    211 - 280
YKILQQIPDHPKHFSIHPDTGVITTTTPFLDREKCDTYQLIMEVRDMGGQPFGLFNTGTITISLEDENDN    281 - 350
PPSFTETSYVTEVEENRIDVEILRMKVQDQDLPNTPHSKAVYKILQGNENGNFIISTDPNTNEGVLCVVK    351 - 420
PLNYEVNRQVILQVGVINEAQFSKAASSQTPTMCTTTVTVKIIDSDEGPECHPPVKVIQSQDGFPAGQEL    421 - 490
LGYKALDPEISSGEGLRYQKLGDEDNWFEINQHTGDLRTLKVLDRESKFVKNNQYNISVVAVDAVGRSCT    491 - 560
GTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAI    561 - 630
LRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTRDVRPNVILGRWAILAMVLG    631 - 700
SVLLLCILFTCFCVTAKRTVKKCFPEDIAQQNLIVSNTEGPGEEVTEANIRLPMQTSNICDTSMSVGTVG    701 - 770
GQGIKTQQSFEMVKGGYTLDSNKGGGHQTLESVKGVGQGDTGRYAYTDWQSFTQPRLGEKVYLCGQDEEH    771 - 840
KHCEDYVCSYNYEGKGSLAGSVGCCSDRQEEEGLEFLDHLEPKFRTLAKTCIKK                    841 - 894
//

Text Mined References (39)

PMID Year Title
25723181 2015 Expression of desmosomal proteins in acantholytic squamous cell carcinoma of the skin.
25488293 2015 Transcriptional regulation of genes involved in keratinocyte differentiation by human papillomavirus 16 oncoproteins.
25244249 2015 Pemphigus herpetiformis with IgG autoantibodies to desmoglein 1 and desmocollin 1.
23975055 2014 The influence of desmocollin 1-3 expression on prognosis after curative resection of colorectal liver metastases.
23824361 2014 IgA paraneoplastic pemphigus in angioimmunoblastic T-cell lymphoma with antibodies to desmocollin 1, type VII collagen and laminin 332.
23797684 IgA pemphigus with non-pustular erythematous lesions and IgA antibodies to desmocollins 1 and 2.
23715433 2013 Coexistence of pemphigus herpetiformis with IgG antibodies to desmocollin 1 and pemphigoid with IgG antibodies to BP180 C-terminal domain and laminin ?2.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23412934 2013 A genome-wide association study of brain lesion distribution in multiple sclerosis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...