Property Summary

NCBI Gene PubMed Count 24
Grant Count 248
R01 Count 196
Funding $21,968,008.49
PubMed Score 344.72
PubTator Score 30.24

Knowledge Summary

Patent

No data available

Expression

Synonym

Gene

PANTHER Protein Class (2)

PDB

1YB5  

Gene RIF (7)

PMID Text
23898208 HIV-1 Tat downregulates the expression of crystallin, zeta (CRYZ; quinone reductase) in human primary T cells
22843503 Our results suggest that genetic variants in TYW3/CRYZ and NDST4 loci may be involved in the regulation of circulating resistin levels
21276778 role of Zta1p in the yeast adaptation to some stress types and the general functional significance of zeta-crystallins
20835842 novel enzymatic activity for human zeta-crystallin, the double- bond a,b-hydrogenation of 2-alkenals and 3-alkenones, was identified.
20103721 zeta-Crystallin is a bcl-2 mRNA binding protein involved in bcl-2 overexpression in T-cell acute lymphocytic leukemia.
12714703 up-regulation of quinone reductase can protect breast cells against oxidative DNA damage
11295131 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MATGQKLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPG      1 - 70
SDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRAL     71 - 140
IHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIK    141 - 210
KYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQ    211 - 280
QYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGSGATGKMILLL                         281 - 329
//

Text Mined References (32)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22843503 2012 Genome-wide association analysis identifies TYW3/CRYZ and NDST4 loci associated with circulating resistin levels.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21276778 2011 Novel alkenal/one reductase activity of yeast NADPH:quinone reductase Zta1p. Prospect of the functional role for the ?-crystallin family.
21269460 2011 Initial characterization of the human central proteome.
20835842 2011 Kinetic and structural evidence of the alkenal/one reductase specificity of human ?-crystallin.
More...