Property Summary

NCBI Gene PubMed Count 24
PubMed Score 411.17
PubTator Score 30.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute myeloid leukemia -3.000 3.6e-02
atypical teratoid / rhabdoid tumor 1.300 6.2e-06
ependymoma 1.200 5.8e-05
glioblastoma 1.100 1.7e-03
head and neck cancer -1.100 4.5e-03
interstitial cystitis -1.300 1.0e-02
lung adenocarcinoma 1.066 3.8e-03
lung cancer 1.800 7.7e-04
malignant mesothelioma -1.500 9.1e-07
ovarian cancer -1.900 1.2e-04
pancreatic ductal adenocarcinoma liver m... -1.707 1.3e-02
pediatric high grade glioma 1.300 9.9e-04
Waldenstrons macroglobulinemia 1.141 4.9e-02

Gene RIF (7)

AA Sequence

MATGQKLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPG      1 - 70
SDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRAL     71 - 140
IHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIK    141 - 210
KYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQ    211 - 280
QYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGSGATGKMILLL                         281 - 329
//

Text Mined References (32)

PMID Year Title