Property Summary

NCBI Gene PubMed Count 33
PubMed Score 110.38
PubTator Score 47.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.600 2.3e-03
Astrocytoma, Pilocytic -1.500 1.8e-03
ependymoma -1.800 4.3e-03
invasive ductal carcinoma 1.400 1.8e-02
lung cancer 3.800 4.7e-05
medulloblastoma, large-cell 1.100 2.0e-02
Multiple myeloma -1.079 4.9e-05
oligodendroglioma -1.500 2.7e-03
psoriasis -1.200 3.9e-02
Waldenstrons macroglobulinemia -1.129 1.8e-03

 GO Component (1)

Gene RIF (25)

AA Sequence

MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVSTATDSSYYTNQ      1 - 70
QHPAGGGGGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDLGYTAAYTSYAPYGTSSSPANNEPEKEDLEP     71 - 140
EIRIVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKM    141 - 210
WKSGEIPSEQHPGASASPPCASPPVSAPASWDFGVPQRMAGGGGPGSGGSGAGSSGSSPSSAASAFLGNY    211 - 280
PWYHQTSGSASHLQATAPLLHPTQTPQPHHHHHHHGGGGAPVSAGTIF                          281 - 328
//

Text Mined References (37)

PMID Year Title