Property Summary

NCBI Gene PubMed Count 28
Grant Count 60
R01 Count 38
Funding $5,004,661.45
PubMed Score 105.47
PubTator Score 47.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.129 0.002
Multiple myeloma -1.079 0.000
astrocytic glioma -1.600 0.002
ependymoma -1.800 0.004
oligodendroglioma -1.500 0.003
psoriasis -1.200 0.039
medulloblastoma, large-cell 1.100 0.020
lung cancer 6.800 0.000
pilocytic astrocytoma -1.600 0.002
invasive ductal carcinoma 1.400 0.018

Synonym

Accession Q07687 B4DMK4 B7ZA14
Symbols TES1
TES-1

Gene

 GO Component (1)

Gene RIF (20)

PMID Text
26833729 DLX2 expression reduces the protein components of the TTI1/TTI2/TEL2 complex, a key complex required for the proper folding and stabilization of ATM and other members of the PIKK family kinase, leading to reduced ATM-p53 signaling and senescence bypass
26799321 DLX2 plays a crucial role in radioresistance, radiation-induced epithelial to mesenchymal transition and cancer stem cell marker expression, and the expression of DLX2 is regulated by Smad2/3 signaling in A549 and MDA-MB-231 cell lines.
25651912 Results showed that Dlx-2 is involved in TGF-beta- and Wnt-induced epithelial-mesenchymal transition, glycolytic switch, and mitochondrial repression by Snail activation.
24756434 The activation of DLX2 signaling might improve tissue regeneration mediated by MSCs of dental origin. Results provide insight into the mechanism underlying the directed differentiation of MSCs of dental origin.
23674878 Increased expression of DLX2 may correlate with the advanced stage of gastric adenocarcinoma, and it may contribute to tumor development.
23331016 overexpression of DLX2 indicated poor survival in the 83 glioblastoma multiforme patients
23312518 Dlx2 (and Dlx1) are required to generate cortical interneurons in the medial ganglionic eminence.
21917150 Dlx-2 may be involved in tumor progression via the regulation of metabolic stress-induced necrosis
21357706 These findings suggest that alterations in DLX1/2 contribute to the biological consequences of FLT3 activation.
21108812 MDA-MB-231 breast neoplasms expressed DLX2.
More...

AA Sequence

MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVSTATDSSYYTNQ      1 - 70
QHPAGGGGGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDLGYTAAYTSYAPYGTSSSPANNEPEKEDLEP     71 - 140
EIRIVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKM    141 - 210
WKSGEIPSEQHPGASASPPCASPPVSAPASWDFGVPQRMAGGGGPGSGGSGAGSSGSSPSSAASAFLGNY    211 - 280
PWYHQTSGSASHLQATAPLLHPTQTPQPHHHHHHHGGGGAPVSAGTIF                          281 - 328
//

Text Mined References (32)

PMID Year Title
26833729 2016 A gain-of-function senescence bypass screen identifies the homeobox transcription factor DLX2 as a regulator of ATM-p53 signaling.
26799321 2016 Smad2/3-Regulated Expression of DLX2 Is Associated with Radiation-Induced Epithelial-Mesenchymal Transition and Radioresistance of A549 and MDA-MB-231 Human Cancer Cell Lines.
25651912 2015 Dlx-2 is implicated in TGF-?- and Wnt-induced epithelial-mesenchymal, glycolytic switch, and mitochondrial repression by Snail activation.
25416956 2014 A proteome-scale map of the human interactome network.
24756434 2014 Distal-less homeobox 2 promotes the osteogenic differentiation potential of stem cells from apical papilla.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
23674878 2013 Increased expression of DLX2 correlates with advanced stage of gastric adenocarcinoma.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23331016 2013 Upregulation of DLX2 confers a poor prognosis in glioblastoma patients by inducing a proliferative phenotype.
23312518 2013 Dlx1&2-dependent expression of Zfhx1b (Sip1, Zeb2) regulates the fate switch between cortical and striatal interneurons.
More...