Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.77
PubTator Score 7.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Monkeypox 10 4.321 2.2
Smallpox 20 3.077 1.5

Expression

Gene RIF (2)

PMID Text
24935923 Data indicate that NKG2 receptor NKG2E was capable of associating with CD94 and DAP12 but that the complex was retained intracellularly at the endoplasmic reticulum.
24177169 Data indicate that the expression of KLRD1 (CD94) and NKG2E (KLRC3) was reduced in NK-enriched cells in fulminant type 1 diabetes.

AA Sequence

MSKQRGTFSEVSLAQDPKWQQRKPKGNKSSISGTEQEIFQVELNLQNASLNHQGIDKIYDCQGLLPPPEK      1 - 70
LTAEVLGIICIVLMATVLKTIVLIPFLEQNNSSPNARTQKARHCGHCPEEWITYSNSCYYIGKERRTWEE     71 - 140
SLQACASKNSSSLLCIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHEIKDSDHAERNCAML    141 - 210
HVRGLISDQCGSSRIIRRGFIMLTRLVLNS                                            211 - 240
//

Text Mined References (9)

PMID Year Title
24935923 2014 Human NKG2E is expressed and forms an intracytoplasmic complex with CD94 and DAP12.
24177169 Low gene expression levels of activating receptors of natural killer cells (NKG2E and CD94) in patients with fulminant type 1 diabetes.
16541075 2006 The finished DNA sequence of human chromosome 12.
11751968 2002 Conservation and variation in human and common chimpanzee CD94 and NKG2 genes.
10201920 1999 Triggering of effector functions on a CD8+ T cell clone upon the aggregation of an activatory CD94/kp39 heterodimer.
9683661 1998 The genomic organization of NKG2C, E, F, and D receptor genes in the human natural killer gene complex.
9598306 1998 Sequence analysis of a 62-kb region overlapping the human KLRC cluster of genes.
8943374 1996 Human natural killer cell receptors involved in MHC class I recognition are disulfide-linked heterodimers of CD94 and NKG2 subunits.
8276468 1994 Natural killer lectin-like receptors have divergent carboxy-termini, distinct from C-type lectins.