1. Home
  2. Targets
  3. signaling molecule
  4. membrane-bound signaling molecule
  5. Early activation antigen CD69

Tbio Early activation antigen CD69

Involved in lymphocyte proliferation and functions as a signal transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets.

This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets. [provided by RefSeq, Aug 2011]

 Comments

Property Summary

NCBI Gene PubMed Count 64
PubMed Score 1484.95
PubTator Score 723.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung carcinoma 2844 5.90563341042244E-20
non-small cell lung cancer 2798 1.29156126023793E-19
psoriasis 6685 4.55635570704536E-8
lung cancer 4473 5.23833070271317E-7
pilocytic astrocytoma 3086 1.10739060056021E-6
lung adenocarcinoma 2714 1.61046387955076E-5
ulcerative colitis 2087 1.70759134277789E-5
posterior fossa group A ependymoma 1511 2.63776665545463E-5
primary Sjogren syndrome 789 1.08029878816547E-4
osteosarcoma 7933 1.58651035753386E-4
inflammatory breast cancer 404 2.86929995406952E-4
cutaneous lupus erythematosus 1056 3.2078923044134E-4
adult high grade glioma 2148 4.65842187179189E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00275083242570983
glioblastoma 5572 0.00289085285245303
acute myeloid leukemia 785 0.00322898243284967
hepatocellular carcinoma 550 0.00877916691299251
interstitial cystitis 2299 0.0206935444369446
astrocytoma 1493 0.0286355880530406
invasive ductal carcinoma 2950 0.0321353901258927
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0332791350523152
Waldenstrons macroglobulinemia 765 0.0339443680601565
aldosterone-producing adenoma 664 0.0411739424485537
interstitial lung disease 292 0.0418835755844723
Disease Target Count Z-score Confidence
Type 1 diabetes mellitus 104 0.0 2.0

Expression

  Differential Expression (24)

Disease log2 FC p
hepatocellular carcinoma -1.100 0.009
interstitial lung disease -2.500 0.042
Waldenstrons macroglobulinemia 2.133 0.034
cutaneous lupus erythematosus 3.700 0.000
osteosarcoma -4.007 0.000
posterior fossa group A ependymoma 1.700 0.000
glioblastoma 1.900 0.003
astrocytoma 1.300 0.029
non-small cell lung cancer -2.752 0.000
intraductal papillary-mucinous carcinoma... -2.400 0.003
intraductal papillary-mucinous neoplasm ... -1.800 0.033
lung cancer -6.100 0.000
interstitial cystitis 1.300 0.021
lung adenocarcinoma -2.074 0.000
adult high grade glioma 2.000 0.000
pilocytic astrocytoma 2.700 0.000
primary Sjogren syndrome 2.600 0.000
aldosterone-producing adenoma -1.057 0.041
psoriasis -1.600 0.000
inflammatory breast cancer -1.100 0.000
lung carcinoma -3.200 0.000
invasive ductal carcinoma 1.600 0.032
acute myeloid leukemia 2.100 0.003
ulcerative colitis 2.700 0.000

Synonym

Accession Q07108
Symbols AIM
EA1
MLR-3
CLEC2C
GP32/28
BL-AC/P26

Gene

CD69

PANTHER Protein Class (2)

PDB

1E87   1E8I   1FM5   3CCK   3HUP  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid

 GO Function (3)

 GO Component (2)

 GO Process (1)

 Compartment GO Term (34)

See all...

 MGI Term (4)

 GWAS Trait (1)

 HCA RNA Cell Line (30)

See all...

Pathway (5)

 UniProt Keyword (12)

See all...

Gene RIF (52)

PMID Text
26296369 results demonstrate the functional and mechanistic interplays between CD69 and S100A8/S100A9 in supporting Treg-cell differentiation
24975965 Elevated expression of CD69 and CD161 on NK cells can be considered as immunological risk markers in RSA and IVF failure.
24752896 these findings identify CD69 and galectin-1 to be a novel regulatory receptor-ligand pair that modulates Th17 effector cell differentiation and function.
24668348 Human tumor-infiltrating CD4+CD69+ T cells suppress T cell proliferation via membarene -bound TGF-beta1.
24495362 Cells expressing HIV-1 Nef from long-term non-progressors and progressive infection patients induce higher surface levels of CD69 and CD25 than cells producing HIV-2 or SIV Nef
24341794 Cells expressing HIV-1 Nef from long-term non-progressors and progressive infection patients induce higher surface levels of CD69 and CD25 than cells producing HIV-2 or SIV Nef
24044963 Following coculture with GTKO/CD46 pig mesenchymal stromal cells, it is possible that upregulation of CD69 on human T cells initiates signaling events that would regulate CD4+ and CD8+ T cell activation and differentiation.
23954168 REVIEW: CD69 exerts a complex immunoregulatory role in humans, and that it could be considered as a target molecule for the therapy of immune-mediated diseases
23758320 CD69 is induced by integrin alpha4beta1 outside-in signalling and T-cell receptor signalling.
23546309 This is the first report of the regulation of CD69 expression by LMP-1, and this novel finding may, thus, represent an important link between the EBV oncoprotein LMP-1 and its critical role in the development of EBV-associated diseases.
More...

AA Sequence 

MSSENCFVAENSSLHPESGQENDATSPHFSTRHEGSFQVPVLCAVMNVVFITILIIALIALSVGQYNCPG      1 - 70
QYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREE     71 - 140
HWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK               141 - 199
//

Text Mined References (65)

PMID Year Title
26296369 2015 Glycosylation-dependent interaction between CD69 and S100A8/S100A9 complex is required for regulatory T-cell differentiation.
25416956 2014 A proteome-scale map of the human interactome network.
24975965 2014 Increase of CD69, CD161 and CD94 on NK cells in women with recurrent spontaneous abortion and in vitro fertilization failure.
24752896 2014 The leukocyte activation receptor CD69 controls T cell differentiation through its interaction with galectin-1.
24668348 2014 Human hepatocellular carcinoma-infiltrating CD4?CD69?Foxp3? regulatory T cell suppresses T cell response via membrane-bound TGF-?1.
24044963 Human T cells upregulate CD69 after coculture with xenogeneic genetically-modified pig mesenchymal stromal cells.
23954168 2013 Is CD69 an effective brake to control inflammatory diseases?
23758320 2013 CD25 and CD69 induction by ?4?1 outside-in signalling requires TCR early signalling complex proteins.
23546309 2013 Epstein-Barr virus latent membrane protein 1 induces CD69 expression through activation of nuclear factor-?B.
23507197 2013 CD69 overexpression by human T-cell leukemia virus type 1 Tax transactivation.
More...