Property Summary

NCBI Gene PubMed Count 67
PubMed Score 1542.71
PubTator Score 723.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Type 1 diabetes mellitus 109 0.0 3.0

Expression

  Differential Expression (24)

Disease log2 FC p
acute myeloid leukemia 2.100 3.2e-03
adult high grade glioma 2.000 4.7e-04
aldosterone-producing adenoma -1.057 4.1e-02
astrocytoma 1.300 2.9e-02
Astrocytoma, Pilocytic 2.700 8.5e-07
Breast cancer -1.100 2.7e-03
cutaneous lupus erythematosus 3.700 3.2e-04
ependymoma 1.300 1.4e-04
glioblastoma 1.700 1.3e-05
hepatocellular carcinoma -1.100 8.8e-03
interstitial cystitis 1.300 2.1e-02
interstitial lung disease -2.500 4.2e-02
intraductal papillary-mucinous carcinoma... -2.400 2.8e-03
intraductal papillary-mucinous neoplasm ... -1.800 3.3e-02
invasive ductal carcinoma 1.600 3.2e-02
lung adenocarcinoma -1.100 8.6e-05
lung cancer -4.500 1.7e-06
lung carcinoma -3.200 5.9e-20
non primary Sjogren syndrome sicca -1.300 2.5e-02
non-small cell lung cancer -2.752 1.3e-19
osteosarcoma -4.007 1.6e-04
psoriasis -1.600 4.6e-08
ulcerative colitis 2.700 1.7e-05
Waldenstrons macroglobulinemia 2.133 3.4e-02

 GO Process (1)

Gene RIF (55)

AA Sequence

MSSENCFVAENSSLHPESGQENDATSPHFSTRHEGSFQVPVLCAVMNVVFITILIIALIALSVGQYNCPG      1 - 70
QYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREE     71 - 140
HWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK               141 - 199
//

Text Mined References (68)

PMID Year Title