Property Summary

NCBI Gene PubMed Count 64
Grant Count 145
R01 Count 52
Funding $12,202,068.32
PubMed Score 1484.95
PubTator Score 723.86

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q07108
Symbols AIM
EA1
MLR-3
CLEC2C
GP32/28
BL-AC/P26

Gene

PDB

1E87   1E8I   1FM5   3CCK   3HUP  

 GO Process (1)

Gene RIF (52)

PMID Text
26296369 results demonstrate the functional and mechanistic interplays between CD69 and S100A8/S100A9 in supporting Treg-cell differentiation
24975965 Elevated expression of CD69 and CD161 on NK cells can be considered as immunological risk markers in RSA and IVF failure.
24752896 these findings identify CD69 and galectin-1 to be a novel regulatory receptor-ligand pair that modulates Th17 effector cell differentiation and function.
24668348 Human tumor-infiltrating CD4+CD69+ T cells suppress T cell proliferation via membarene -bound TGF-beta1.
24495362 Cells expressing HIV-1 Nef from long-term non-progressors and progressive infection patients induce higher surface levels of CD69 and CD25 than cells producing HIV-2 or SIV Nef
24341794 Cells expressing HIV-1 Nef from long-term non-progressors and progressive infection patients induce higher surface levels of CD69 and CD25 than cells producing HIV-2 or SIV Nef
24044963 Following coculture with GTKO/CD46 pig mesenchymal stromal cells, it is possible that upregulation of CD69 on human T cells initiates signaling events that would regulate CD4+ and CD8+ T cell activation and differentiation.
23954168 REVIEW: CD69 exerts a complex immunoregulatory role in humans, and that it could be considered as a target molecule for the therapy of immune-mediated diseases
23758320 CD69 is induced by integrin alpha4beta1 outside-in signalling and T-cell receptor signalling.
23546309 This is the first report of the regulation of CD69 expression by LMP-1, and this novel finding may, thus, represent an important link between the EBV oncoprotein LMP-1 and its critical role in the development of EBV-associated diseases.
More...

AA Sequence

MSSENCFVAENSSLHPESGQENDATSPHFSTRHEGSFQVPVLCAVMNVVFITILIIALIALSVGQYNCPG      1 - 70
QYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREE     71 - 140
HWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK               141 - 199
//

Text Mined References (65)

PMID Year Title
26296369 2015 Glycosylation-dependent interaction between CD69 and S100A8/S100A9 complex is required for regulatory T-cell differentiation.
25416956 2014 A proteome-scale map of the human interactome network.
24975965 2014 Increase of CD69, CD161 and CD94 on NK cells in women with recurrent spontaneous abortion and in vitro fertilization failure.
24752896 2014 The leukocyte activation receptor CD69 controls T cell differentiation through its interaction with galectin-1.
24668348 2014 Human hepatocellular carcinoma-infiltrating CD4?CD69?Foxp3? regulatory T cell suppresses T cell response via membrane-bound TGF-?1.
24044963 Human T cells upregulate CD69 after coculture with xenogeneic genetically-modified pig mesenchymal stromal cells.
23954168 2013 Is CD69 an effective brake to control inflammatory diseases?
23758320 2013 CD25 and CD69 induction by ?4?1 outside-in signalling requires TCR early signalling complex proteins.
23546309 2013 Epstein-Barr virus latent membrane protein 1 induces CD69 expression through activation of nuclear factor-?B.
23507197 2013 CD69 overexpression by human T-cell leukemia virus type 1 Tax transactivation.
More...