Property Summary

NCBI Gene PubMed Count 48
Grant Count 73
R01 Count 40
Funding $6,493,605.6
PubMed Score 161.40
PubTator Score 117.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q06828 Q15331 Q8IV47 FM
Symbols FM
SLRR2E

Gene

PANTHER Protein Class (1)

 GO Function (1)

Gene RIF (24)

PMID Text
26893379 The data suggest a fibromodulin-modulated collagen cross-linking mechanism where fibromodulin binds to a specific part of the collagen domain and also forms a complex with lysyl oxidase, targeting the enzyme toward specific cross-linking sites.
26600400 The small leucine rich proteoglycan fibromodulin is overexpressed in human prostate epithelial cancer cell lines in culture and human prostate cancer tissue.
26318878 expression levels distinguish chronic lymphocytic leukemia B cells from normal B lymphocytes
26125412 fibromodulin is involved in the inflammatory processes that characterize atherosclerotic plaque vulnerability
24552666 The results suggest that regions within FMOD is associated with ACL injury susceptibility and that genetic sequence variability within genes encoding proteoglycans may potentially modulate the ligament fibril properties.
24355922 Melanocyte-secreted factor FMOD is a key regulator of angiogenesis.
22138190 Hepatic fibromodulin activates hepatic stellate cells and promotes collagen I deposition, which leads to liver fibrosis.
22099931 Associations between higher fibomodulin gene expression and risk factors in chronic lymphocytic leukemia.
22073367 lumican and fibromodulin display different behaviors and that lumican may promote regeneration of the TMJ after degeneration and deformation induced by IL-1 beta.
19710942 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MQWTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDPYPYETYEPYPYGVDEGPAYTYGSPSP      1 - 70
PDPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIALHGNQ     71 - 140
ITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELHLDHNQISRVPNNALEGLENLTALYLQHN    141 - 210
EIQEVGSSMRGLRSLILLDLSYNHLRKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSL    211 - 280
TNNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVVNFSKLQVLRL    281 - 350
DGNEIKRSAMPADAPLCLRLASLIEI                                                351 - 376
//

Text Mined References (52)

PMID Year Title
26893379 2016 Fibromodulin Interacts with Collagen Cross-linking Sites and Activates Lysyl Oxidase.
26600400 2016 The small leucine rich proteoglycan fibromodulin is overexpressed in human prostate epithelial cancer cell lines in culture and human prostate cancer tissue.
26318878 2015 A seven-gene expression panel distinguishing clonal expansions of pre-leukemic and chronic lymphocytic leukemia B cells from normal B lymphocytes.
26125412 2015 Expression of fibromodulin in carotid atherosclerotic plaques is associated with diabetes and cerebrovascular events.
24552666 2014 Genes encoding proteoglycans are associated with the risk of anterior cruciate ligament ruptures.
24355922 2014 Melanocyte-secreted fibromodulin promotes an angiogenic microenvironment.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22622142 2012 Reprogramming of human fibroblasts into multipotent cells with a single ECM proteoglycan, fibromodulin.
22138190 2012 Fibromodulin, an oxidative stress-sensitive proteoglycan, regulates the fibrogenic response to liver injury in mice.
22099931 2011 Study of fibromodulin gene expression in B-cell chronic lymphocytic leukemia.
More...