Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.70
PubTator Score 2.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Breast cancer 3099 1.6258259416241E-22
osteosarcoma 7933 2.92672055812948E-7
atypical teratoid / rhabdoid tumor 4369 7.83851364942673E-7
group 4 medulloblastoma 1875 1.37163041657004E-6
malignant mesothelioma 3163 3.31960962470696E-6
medulloblastoma, large-cell 6234 1.17393813656188E-4
ovarian cancer 8492 1.43449712336098E-4
cystic fibrosis 1670 2.01472684817068E-4
interstitial cystitis 2299 2.82250842654888E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00475577743502502
lung cancer 4473 0.0155098897170216
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0243886074597788
spina bifida 1064 0.0457251670207913

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -2.200 0.000
osteosarcoma -1.586 0.000
group 4 medulloblastoma 1.600 0.000
atypical teratoid / rhabdoid tumor 1.600 0.000
medulloblastoma, large-cell 2.200 0.000
intraductal papillary-mucinous carcinoma... -1.200 0.024
intraductal papillary-mucinous neoplasm ... -1.500 0.005
lung cancer 1.100 0.016
interstitial cystitis -1.100 0.000
cystic fibrosis -1.300 0.000
spina bifida -1.287 0.046
Breast cancer -1.500 0.000
ovarian cancer -1.300 0.000

Synonym

Accession Q06732 Q06731 Q32MA2 Q86XY8 Q8NDW3
Symbols KOX2
KOX31
ZNF11B

Gene

  Ortholog (2)

Species Source
Macaque OMA EggNOG
Pig OMA EggNOG

Gene RIF (1)

PMID Text
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNKVDQKFQGSVSFKDVTVGFTQEEWQHLDPSQRALYRDVMLENYSNLVSVGYCAHKPEVIFRLEQGEEP      1 - 70
WRLEEEFPSQSFPEVWTADHLKERSQENQSKHLWEVVFINNEMLTKEQGNVIGIPFNMDVSSFPSRKMFC     71 - 140
QYDSRGMSFNTVSELVISKINYLGKKSDEFNACGKLLLNIKHDETHTREKNEVLKNRNTLSHRENTLQHE    141 - 210
KIQTLDHNFEYSICQETLLEKAVFNTRKRENAEENNCDYNEFGRTFCDSSSLLFHQIPPSKDSHYEFSDC    211 - 280
EKFLCVKSTLSKHDGVPVKHYDCGESGNNFRRKLCLSQLQKGDKGEKHFECNECGKAFWEKSHLTRHQRV    281 - 350
HTGEKHFQCNQCGKTFWEKSNLTKHQRSHTGEKPFECNECGKAFSHKSALTLHQRTHTGEKPYQCNACGK    351 - 420
TFYQKSDLTKHQRTHTGQKPYECYECGKSFCMNSHLTVHQRTHTGEKPFECLECGKSFCQKSHLTQHQRT    421 - 490
HIGDKPYECNACGKTFYHKSVLTRHQIIHTGLKPYECYECGKTFCLKSDLTIHQRTHTGEKPFACPECGK    491 - 560
FFSHKSTLSQHYRTHTGEKPYECHECGKIFYNKSYLTKHNRTHTGEKPYECNECGKTFCQKSQLTQHQRI    561 - 630
HIGEKPYECNECGKAFCHKSALIVHQRTHTQEKPYKCNECGKSFCVKSGLILHERKHTGEKPYECNECGK    631 - 700
SFSHKSSLTVHHRAHTGEKSCQCNECGKIFYRKSDLAKHQRSHTGEKPYECNTCRKTFSQKSNLIVHQRT    701 - 770
HIGEKPYE                                                                  771 - 778
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22451503 2012 Hormonal and molecular characterization of follicular fluid, cumulus cells and oocytes from pre-ovulatory follicles in stimulated and unstimulated cycles.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12566394 2003 Genomic sequence and transcriptional profile of the boundary between pericentromeric satellites and genes on human chromosome arm 10p.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8464732 1993 Duplicated KOX zinc finger gene clusters flank the centromere of human chromosome 10: evidence for a pericentric inversion during primate evolution.
2288909 1990 Multiple genes encoding zinc finger domains are expressed in human T cells.
More...