Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.95
PubTator Score 2.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.600 7.8e-07
Breast cancer -1.500 1.6e-22
cystic fibrosis -1.300 2.0e-04
group 4 medulloblastoma 1.600 1.4e-06
interstitial cystitis -1.100 2.8e-04
intraductal papillary-mucinous carcinoma... -1.200 2.4e-02
intraductal papillary-mucinous neoplasm ... -1.500 4.8e-03
lung cancer 1.100 1.6e-02
malignant mesothelioma -2.200 3.3e-06
medulloblastoma, large-cell 1.600 2.9e-02
osteosarcoma -1.586 2.9e-07
ovarian cancer -1.300 1.4e-04
spina bifida -1.287 4.6e-02

Gene RIF (1)

AA Sequence

MNKVDQKFQGSVSFKDVTVGFTQEEWQHLDPSQRALYRDVMLENYSNLVSVGYCAHKPEVIFRLEQGEEP      1 - 70
WRLEEEFPSQSFPEVWTADHLKERSQENQSKHLWEVVFINNEMLTKEQGNVIGIPFNMDVSSFPSRKMFC     71 - 140
QYDSRGMSFNTVSELVISKINYLGKKSDEFNACGKLLLNIKHDETHTREKNEVLKNRNTLSHRENTLQHE    141 - 210
KIQTLDHNFEYSICQETLLEKAVFNTRKRENAEENNCDYNEFGRTFCDSSSLLFHQIPPSKDSHYEFSDC    211 - 280
EKFLCVKSTLSKHDGVPVKHYDCGESGNNFRRKLCLSQLQKGDKGEKHFECNECGKAFWEKSHLTRHQRV    281 - 350
HTGEKHFQCNQCGKTFWEKSNLTKHQRSHTGEKPFECNECGKAFSHKSALTLHQRTHTGEKPYQCNACGK    351 - 420
TFYQKSDLTKHQRTHTGQKPYECYECGKSFCMNSHLTVHQRTHTGEKPFECLECGKSFCQKSHLTQHQRT    421 - 490
HIGDKPYECNACGKTFYHKSVLTRHQIIHTGLKPYECYECGKTFCLKSDLTIHQRTHTGEKPFACPECGK    491 - 560
FFSHKSTLSQHYRTHTGEKPYECHECGKIFYNKSYLTKHNRTHTGEKPYECNECGKTFCQKSQLTQHQRI    561 - 630
HIGEKPYECNECGKAFCHKSALIVHQRTHTQEKPYKCNECGKSFCVKSGLILHERKHTGEKPYECNECGK    631 - 700
SFSHKSSLTVHHRAHTGEKSCQCNECGKIFYRKSDLAKHQRSHTGEKPYECNTCRKTFSQKSNLIVHQRT    701 - 770
HIGEKPYE                                                                  771 - 778
//

Text Mined References (13)

PMID Year Title