Property Summary

Ligand Count 4
NCBI Gene PubMed Count 509
PubMed Score 6589.98
PubTator Score 1974.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 3.02039245743481E-13
Disease Target Count
Fanconi anemia 56

Expression

  Differential Expression (17)

Disease log2 FC p
Breast cancer 1.700 3.0e-13
adult high grade glioma 1.500 1.7e-04
atypical teratoid / rhabdoid tumor 1.800 2.6e-07
breast carcinoma 1.300 2.8e-04
glioblastoma 1.700 5.7e-08
group 3 medulloblastoma 2.700 2.3e-06
intraductal papillary-mucinous carcinoma... 1.400 1.1e-03
intraductal papillary-mucinous neoplasm ... 1.700 4.5e-03
invasive ductal carcinoma 1.300 2.8e-03
lung cancer 1.400 7.1e-03
malignant mesothelioma 1.700 1.7e-06
medulloblastoma, large-cell 2.400 7.8e-07
non-small cell lung cancer 2.001 1.7e-20
osteosarcoma -3.767 1.6e-11
ovarian cancer 1.600 2.3e-07
primitive neuroectodermal tumor 2.100 4.1e-05
psoriasis -2.300 4.5e-05

Protein-protein Interaction (6)

Gene RIF (446)

AA Sequence

MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAK      1 - 70
ADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTL     71 - 140
AVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAM    141 - 210
MVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFA    211 - 280
ADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD               281 - 339
//

Text Mined References (517)

PMID Year Title