Property Summary

NCBI Gene PubMed Count 464
Grant Count 1,107
R01 Count 716
Funding $158,940,765.22
PubMed Score 5951.51
PubTator Score 1974.97

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q06609 B0FXP0 B2R8T6 Q6FHX9 Q6ZNA8 Q9BV60 HsRAD51
Symbols RECA
BRCC5
FANCR
MRMV2
HRAD51
RAD51A
HsRad51
HsT16930

Gene

PDB

1N0W   1B22   5JZC  

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
1385 screening 169 / 0 / 198310 Homologous recombination - Rad 51
1435 confirmatory 8 / 0 / 60 Homologous Recombination - Rad 51_Dose response
1436 confirmatory 4 / 3 / 12 Homologous Recombination_Rad51_DNA binding assay
1437 confirmatory 11 / 0 / 84 Homologous recombination_Rad 51_dose response_2

Gene RIF (410)

PMID Text
26990772 Although patient cells were unable to form Rad51 foci following exposure to either DNA damaging agent, U2OS cells, in which the mutant PALB2 with in frame skip of exon 6 was induced, did show recruitment of Rad51 to foci following damage.
26811421 TOPBP1 physically binds PLK1 and promotes PLK1 kinase-mediated phosphorylation of RAD51 at serine 14, a modification required for RAD51 recruitment to chromatin.
26752698 gefitinib dramatically promotes the ubiquitin-proteasome-dependent degradation of Rad51 protein
26699641 Overall, these results indicate that Rad51 and BRCA1 are required for the process of human papillomavirus 31 genome amplification and suggest that productive replication occurs in a manner dependent upon recombination.
26676960 The expression of DSB repair proteins such as RAD51 and MRE11 was investigated by immunohistochemistry, and associations between RAD51 and MRE11 expression and clinicopathological factors or chemotherapeutic effect were assessed
26650628 that polymorphisms in the 5'-UTR promoter region of the RAD51 gene are prognostic factors for BC development
26627254 Rad51 recombinase prevents Mre11 nuclease-dependent degradation and excessive PrimPol-mediated elongation of nascent DNA after UV irradiation
26511493 RAD51 rs1801320 can modify the glioblastoma risk alone as well as in combination with other polymorphisms.
26507587 RAD51 polymorphism is associated with nonsyndromic cleft lip with cleft palate.
26406958 The results suggest that the RAD51 G135C and XRCC1 Arg399Gln polymorphisms could be biomarkers of susceptibility for ovarian carcinoma development. Further larger case-control study is needed to confirm our findings
More...

AA Sequence

MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAK      1 - 70
ADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTL     71 - 140
AVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAM    141 - 210
MVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFA    211 - 280
ADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD               281 - 339
//

Text Mined References (474)

PMID Year Title
26990772 2016 A Hypomorphic PALB2 Allele Gives Rise to an Unusual Form of FA-N Associated with Lymphoid Tumour Development.
26811421 2016 TOPBP1 regulates RAD51 phosphorylation and chromatin loading and determines PARP inhibitor sensitivity.
26752698 2016 Gefitinib Synergizes with Irinotecan to Suppress Hepatocellular Carcinoma via Antagonizing Rad51-Mediated DNA-Repair.
26699641 2015 Homologous Recombination Repair Factors Rad51 and BRCA1 Are Necessary for Productive Replication of Human Papillomavirus 31.
26681308 2015 A novel Fanconi anaemia subtype associated with a dominant-negative mutation in RAD51.
26676960 2016 Expression of DNA double-strand break repair proteins predicts the response and prognosis of colorectal cancer patients undergoing oxaliplatin-based chemotherapy.
26650628 2016 Homozygous T172T and Heterozygous G135C Variants of Homologous Recombination Repairing Protein RAD51 are Related to Sporadic Breast Cancer Susceptibility.
26627254 2015 Rad51 recombinase prevents Mre11 nuclease-dependent degradation and excessive PrimPol-mediated elongation of nascent DNA after UV irradiation.
26511493 2016 Association between RAD 51 rs1801320 and susceptibility to glioblastoma.
26507587 2016 Interactions between RAD51 rs1801321 and maternal cigarette smoking as risk factor for nonsyndromic cleft lip with or without cleft palate.
More...