Property Summary

NCBI Gene PubMed Count 464
PubMed Score 5951.51
PubTator Score 1974.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Breast cancer 2.200 2.4e-09
malignant mesothelioma 1.900 6.9e-08
psoriasis -2.300 4.5e-05
osteosarcoma -3.767 1.6e-11
glioblastoma 1.800 2.6e-05
group 3 medulloblastoma 2.700 2.3e-06
atypical teratoid / rhabdoid tumor 1.800 2.6e-07
medulloblastoma, large-cell 2.400 7.8e-07
primitive neuroectodermal tumor 2.100 4.1e-05
non-small cell lung cancer 2.001 1.7e-20
intraductal papillary-mucinous carcinoma... 1.400 1.1e-03
intraductal papillary-mucinous neoplasm ... 1.700 4.5e-03
lung cancer 1.700 2.3e-05
breast carcinoma 1.300 2.8e-04
pediatric high grade glioma 1.700 1.7e-06
invasive ductal carcinoma 1.300 2.8e-03
ovarian cancer 1.600 2.3e-07

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
1385 screening 169 / 0 / 198310 Homologous recombination - Rad 51
1435 confirmatory 8 / 0 / 60 Homologous Recombination - Rad 51_Dose response
1436 confirmatory 4 / 3 / 12 Homologous Recombination_Rad51_DNA binding assay
1437 confirmatory 11 / 0 / 84 Homologous recombination_Rad 51_dose response_2

Gene RIF (406)

PMID Text
26990772 Although patient cells were unable to form Rad51 foci following exposure to either DNA damaging agent, U2OS cells, in which the mutant PALB2 with in frame skip of exon 6 was induced, did show recruitment of Rad51 to foci following damage.
26811421 TOPBP1 physically binds PLK1 and promotes PLK1 kinase-mediated phosphorylation of RAD51 at serine 14, a modification required for RAD51 recruitment to chromatin.
26752698 gefitinib dramatically promotes the ubiquitin-proteasome-dependent degradation of Rad51 protein
26699641 Overall, these results indicate that Rad51 and BRCA1 are required for the process of human papillomavirus 31 genome amplification and suggest that productive replication occurs in a manner dependent upon recombination.
26676960 The expression of DSB repair proteins such as RAD51 and MRE11 was investigated by immunohistochemistry, and associations between RAD51 and MRE11 expression and clinicopathological factors or chemotherapeutic effect were assessed
26650628 that polymorphisms in the 5'-UTR promoter region of the RAD51 gene are prognostic factors for BC development
26627254 Rad51 recombinase prevents Mre11 nuclease-dependent degradation and excessive PrimPol-mediated elongation of nascent DNA after UV irradiation
26511493 RAD51 rs1801320 can modify the glioblastoma risk alone as well as in combination with other polymorphisms.
26507587 RAD51 polymorphism is associated with nonsyndromic cleft lip with cleft palate.
26406958 The results suggest that the RAD51 G135C and XRCC1 Arg399Gln polymorphisms could be biomarkers of susceptibility for ovarian carcinoma development. Further larger case-control study is needed to confirm our findings
26339569 The aim of the present study was to evaluate the relationship between prostate cancer risk and the presence of single nucleotide polymorphisms in the genes involved in Homologous recombination repair, RAD51, RAD51B, XRCC2 and XRCC3.
26166705 Results show that BOD1L protects against severe genome instability caused by replication stress; it maintains fork stability by stabilizing RAD51 nucleofilaments.
26133502 Nrf2 inhibition led to significant reduction in mRNA levels of RAD51
26123175 hCAS/CSE1L is responsible for controlling the homologous recombinational repair activity by directly interacting with RAD51.
26119522 Higher scores for intestinal metaplasia of G135C carriers compared to those of G135G carriers were observed in H. pylori-positive patients and H. pylori-positive patients with gastritis but were not found in H. pylori-negative patients.
26108708 Studies indicate that RAD51 recombinase genotype 'CC' was a strong risk factor in Caucasians, but not in East-Asians and populations of mixed ethnicity.
26088134 In contrast to RAD51, stabilization of the presynaptic filament via ATP hydrolysis attenuation is insufficient for enhancement of the DMC1-catalyzed recombination reaction.
25813273 RAD51 mutation was found in individuals with actual congenital mirror movements.
25765654 support a model in which RAD54L and RAD54B counteract genome-destabilizing effects of direct binding of RAD51 to dsDNA in tumor cells
25753674 Inhibition of ATM after completion of end resection did not affect RAD51 nucleofilament formation, but resulted in homologous recombination deficiency.
25743260 Polymorphism of RAD51, but not of XRCC2 gene, may be positively associated with the incidence of triple-negative breast carcinoma.
25733714 work establishes remodeling of uncoupled forks as a pivotal RAD51-regulated response to genotoxic stress in human cells and as a promising target to potentiate cancer chemotherapy.
25617833 HDHB promotes homologous recombination in vivo and stimulates 5'-3' heteroduplex extension during Rad51-mediated strand exchange in vitro
25612937 Variants of the DNA damage repair gene RAD51 increase the risk of esophageal cancer
25585578 FBH1 acts as a negative regulator of RAD51 function in human cells
25556492 Homozygous variant CC genotype of RAD51 135G/C was associated with a 2.5 fold increased head and neck cancer risk, while a 172 G/T heterozygous variant GT genotype was associated with a 1.68 fold elevation when compared with controls.
25556451 The heterozygous variant genotype (GC) of RAD51 135 G/C polymorphism was associated with a significantly increased risk of breast cancer in a Pakistani cohort.
25542228 the aim of this study was to evaluate the clinical response to platinum-based chemotherapy and treatment outcome of gastric cancer patients in the present of ERCC1, ERCC2, NBN, RAD51, and XRCC3 gene polymorphisms.
25539919 The study demonstrated that tumor-associated variants in human RAD51 have functional phenotypes including changes in the physical properties of RAD51-DNA filaments, and changes in the catalytic activities of these filaments.
25499220 Thus, Fulvestrant but not Tamoxifen, antagonist against ER-alpha, can restore the Taxol sensitivity in VHL- or BRCA1-deficient cells. Our results suggest that pVHL-mediated ER-alpha suppression is important for regulation of MTOC as well as drug resistance.
25417706 Significantly restored tolerance of RAD18-/- and RNF8-/- cells to camptothecin and olaparib without affecting Rad51 focus formation.
25395584 BRG1-RAD52 complex mediates the replacement of RPA with RAD51 on single-stranded DNA (ssDNA) to initiate DNA strand invasion. Loss of BRG1 results in a failure of RAD51 loading onto ssDNA, abnormal homologous recombination repair
25365323 We have demonstrated that Rad51 and Rad52 dependent homologous recombination is coupled to HSV-1 DNA replication.
25354554 Results suggest that the RAD51 135G>C polymorphism predicts CMF chemotherapy effect in early breast cancer.
25310191 The induction of Rad51 resulting from infection with polyomavirus JC (JCV) acts through NF-kappaB via its binding site to stimulate JCV early transcription.
25288749 analysis of nascent RAD51 filament formation at single-monomer resolution
25282148 BRCA2 exists as a dimer and that two oppositely oriented sets of RAD51 molecules bind the dimer RAD51 to facilitate rad51-mediated homologous-recombinational repair.
25175062 Results suggest that inhibition of autophagy enhances the susceptibility of nasopharyngeal carcinoma cells to radiation by reducing Rad51 expression.
25110436 Suggest that RAD51 potentiates the synergistic effects of chemotherapy with PCI-24781 and CDDP on gastric cancer.
25035396 Pharmacologic suppression of the HR DNA repair protein RAD51.
24948741 RAD51 is frequently overexpressed in brain metastases from breast cancer and may constitute a mechanism to overcome reactive oxygen species-mediated genotoxic stress in the metastatic brain.
24930116 The results support the hypothesis that RAD51 G135C and G172T polymorphisms may be associated with endometrial cancer occurrence and/or progression.
24927671 The meta-analysis indicates that the RAD51 recombinase (BRCC5) polymorphism may be a candidate modifier of ovarian cancer risk in Caucasians.
24871558 The G135C polymorphism of the RAD51 gene is associated with an increased risk of colorectal cancer in an Indian population.
24859942 Our results indicated that the RAD51 135G/C polymorphism was a candidate for susceptibility of cancer.
24847939 Rad51 interaction with NF-kappaB pathway stimulates expression of HIV-1
24811120 This analysis suggested that RAD51 expression is increased during breast cancer progression and metastasis and an oncogenic role for RAD51 when deregulated.
24808016 Mutations and variants in RAD51 are strongly associated with congenital mirror movements.
24781030 Rad51 promoter is regulated by multiple factors, and that its expression is gradually activated as cells progress toward malignancy.
24708616 The assessment of FANCD2, RAD51, BRCA1 and BRIP1 nuclear proteins could provide important information about the patients at risk for treatment failure.
24662483 Guided by DNA double-strand breaks induced small RNAs Ago2 can promote Rad51 recruitment and/or retention at DNA double-strand breaks to facilitate repair by homologous recombination.
24616504 findings indicate that miR-155 regulates DNA repair activity and sensitivity to IR by repressing RAD51 in breast cancer
24599673 No significant association was found between the RAD51 135G>C polymorphism and the risk of ovarian cancer
24583581 increased Rad51 concentration and homology length interact synergistically to promote 3' extension, presumably as a result of enhanced Brca2-mediated Rad51 polymerization
24576846 GST pulldown experiments revealed that both IE72 and wt p53 bound the important homology-directed repair protein, Rad51.
24568492 RAD51 haplotype polymorphisms are associated with risk of esophageal squamous cell carcinoma.
24525463 Results suggest that downregulation of Rad51 participates in ochratoxin A-induced DNA double-strand breaks in gastric epithelial cells in vitro.
24457040 RAD51 135G/C polymorphism was associated with the risk of squamous cell carcinoma of the head and neck
24375044 Demonstration of a significant positive association between the RAD51 135G>C polymorphism and ovarian carcinoma in Poland.
24244429 results establish a novel mechanism underlying the cooperative antileukemic activities of these drug combinations in which panobinostat suppresses expression of BRCA1, CHK1, and RAD51 to enhance cytarabine and daunorubicin sensitivities in AML cells.
24223453 SNPs of the RAD51 gene may have a role in the keratoconus and Fuchs endothelial corneal dystrophy pathogenesis.
24189466 Genetic variants in RAD51 are not associated with soft-tissue sarcoma.
24114315 our findings suggest association of RAD51 135G>C and TP53 Arg72Pro polymorphisms with breast cancer predisposition in Serbian population.
24108124 FBH1 restraining RAD51 DNA binding under unperturbed growth conditions to prevent unwanted or unscheduled DNA recombination.
24088786 Studies identified RAD51 as a critical target of miR-103/107 in the regulation of homologous recombination and chemosensitivity.
24065387 High Rad51 expression is associated with lymph node metastasis in squamous cell carcinoma of the esophagus.
24056534 RAD51 haploinsufficiency disrupts the corticospinal lateralization of the motor system.
24046452 These findings suggest that the SUMO-SIM system plays an important role in DNA repair, through the regulation of RAD51 dynamics
24040396 the function of the RAD51 135G>C polymorphism in cancer development
24005565 HELQ is associated with the RAD51 paralogs RAD51B/C/D and XRCC2, and with the DNA damage-responsive kinase ATR.
23978154 This meta-analysis provides evidence that the RAD51 and XRCC3 polymorphisms are not associated with an increased risk of AML in the total population.
23977219 XRCC3 and RAD51 are significantly associated with clinicopathological factors in breast cancer.
23955800 RAD51 -135G/C polymorphism might be associated with increased risk for MDS; however, there is lack of evidence indicating association between this polymorphism and susceptibility of acute leukemia.
23868022 The risk allele T of rs10483810 in RAD51 gene is associated with an increased risk of advanced age-related macular degeneration.
23810717 The HsRAD51B-HsRAD51C complex plays a role in stabilizing the HsRAD51 nucleoprotein filament during the presynaptic phase of homologous recombination.
23801766 different architectural arrangements we observe for RAD54 with RAD51-DNA filaments may reflect the diverse roles of this protein in homologous recombination
23757189 RAD51 dsDNA nucleoprotein filament disassembles nucleosomes by unwrapping the DNA from the core histones.
23754376 RAD51-binding protein fidgetin-like 1 (FIGNL1)is reported. FIGNL1 specifically interacts with RAD51 through its conserved RAD51 binding domain. Cells depleted of FIGNL1 show defective homologous recombination repair.
23678008 p53 suppresses BRCA2-stimulated ATPase and strand exchange functions of human RAD51 to control homologous recombination.
23625599 RAD51 polymorphisms may be regarded as predictive factors of triple-negative breast cancer in the female population.
23591384 These findings highlight an important new role for Rad51 in supporting mtDNA replication, and further promote the idea that recombination is indispensable for sustaining DNA synthesis under conditions of replication stress.
23570471 The possible influence of the RAD51 genetic variants in damage repair capacity.
23509288 Consistent with its role as a scaffolding protein for the assembly of BLM and RAD51 foci, cells depleted of SPIDR show increased rate of sister chromatid exchange and defects in homologous recombination repair.
23404160 Case-control study to check an association between the genotypes of the c.-61 G>T and the g.38922 C>G polymorphisms of the RAD51 gene and the g.96267 A>C and the g.85394 A>G polymorphisms of the BLM gene and breast cancer occurrence.
23401855 Chromatin immunoprecipitation analysis using human DR-GFP cells demonstrated that MCM8 and MCM9 proteins are rapidly recruited to DNA damage sites and promote RAD51 recruitment.
23341130 RAD51 recombinase inhibitor overcomes imatinib-resistance in chronic myeloid leukaemia.
23318456 spontaneous RAD51 foci were reduced in uveal melanoma and PD20 cells compared with FANCD2-proficient cells
23300655 RAD51 tolerates so little dysfunctional sequence variation that rare variants in the gene contribute little, if anything, to breast cancer susceptibility
23285190 CBP and p300 histone acetyltransferases contribute to homologous recombination by transcriptionally activating the BRCA1 and RAD51 genes.
23266955 p400 and Rad51 are present in the same complex and both favor chromatin remodeling around DNA double strand breaks.
23161237 Our results suggest that variant genotypes of the 135G>C of RAD51 polymorphism may be positively associated with colorectal carcinoma in the Polish population
23149936 Human Rad51 paralogs facilitate BRCA2-Rad51-dependent homologous recombination at different stages in the pathway and function independently of Rad52.
23091899 the polymorphism 135G > C of RAD51 may be positively associated with ovarian carcinoma in the Polish population.
23065657 RAD51 overexpression is associated with colorectal adenocarcinoma.
23065228 There was a significant association of breast cancer risk with RAD51 GG and CC polymorphism.
22935458 Our study reveal no significance association of 135 G/C RAD51 polymorphism with occurrence and progression of colorectal cancer.
22865450 Data indicate that RNF8-dependent chromatin ubiquitination is required for RAD51 assembly in BRCA1/53BP1-depleted cells.
22789542 show a repair-independent requirement for FA genes, including FANCD2, and BRCA1 in protecting stalled replication forks from degradation
22778135 study found low levels of mutant RAD51 protein were sufficient for disruption of RAD51 activity and generation of chromosomal rearrangements.
22729783 The results of this study suggest that SAHA, a recently approved HDI in clinical trials for malignancies, at lower concentrations may act as a radiosensitizer via disruption of the RAD51-dependent HDR pathway.
22645136 Data indicate taht BRC repeat is a common RAD51 recombinase interaction module that can either promote homologous recombination (HR), as in the case of BRCA2, or to suppress HR, as in RECQL5 helicase.
22634097 first study evaluating the role of the RAD51 G172T genetic variants in cancer prognosis and clinical outcome of cervical cancer patients; results indicate an influence of the RAD51 genetic variants in overall survival of cervical cancer
22613844 genetic variability of Xrcc3 and/or Rad51 genes might be of relevance with respect to HNC risk
22611952 The results support the hypothesis that polymorphism of RAD51 may be associated with the incidence of sporadic breast cancer in Polish women.
22587838 DNA damage repair is mediated by the binding of HSF4 to a heat shock element in the Rad51 promoter, a gene which assists in the homologous recombination (HR) repair of DNA strand breaks.
22580645 RAD51 expression could be one of the most important predictive factors of preoperative chemoradiography for advanced lower rectal cancer.
22487057 genetic association study in population in Poland: Data suggest an SNP in RAD51 (G135C in 5prime untranslated region) is associated with endometrial carcinoma in population studied; SNPs in XRCC2 (Arg188His) and XRCC3 (Thr241Met) are not associated.
22362735 It is proposed that Ca(2+) stabilizes the L2 loop conformation of Rad51 and thereby the protein-DNA interaction.
22325354 S14 followed by T13 phosphorylation of Rad51 facilitates Rad51 recruitment to damage sites, thus enhancing cellular resistance to genotoxic stresses
22305526 RAD51 mRNA was significantly downregulated in individuals with CMM resulting from the degradation of the mutated mRNA by nonsense-mediated decay.
22275364 HsRAD51(Asp-316) salt bridge functions as a conformational sensor that enhances turnover at the expense of recombinase activity.
22274865 Mechanistic investigation revealed that methotrexate led to a significant reduction in the transcription of RAD51 genes.
22174876 These experiments demonstrated that a small core domain of the Rad51 promoter can be used to target selective transgene expression from adenoviral vectors to tumor cells lacking functional p53.
22102073 Polymorphism 135G>C of the RAD51 gene may be positively associated with endometrial carcinoma in the Polish population.
22013044 hRAD51 enhanced the endogenous DNA repair process and inhibited the virus integration step.
22013044 K133A RAD51 mutant remains to bind DNA but is unable to form an active nucleofilament due to the poor binding of ATP, which results in the defect on IN inhibition
21998700 a novel functional connection between PML and the homologous recombination-mediated repair machinery
21987080 We found that haplotypes in APEX1, BRCA2, ERCC2, and RAD51 were significantly associated with total childhood acute lymphoblastic leukemia
21926087 Loss of RAD51 is associated with glioma.
21915862 These data suggest that genetic polymorphisms of RAD51 may not play an important role in clearance of hepatitis B virus and disease progression to hepatocellular carcinoma.
21858113 Data show that that RAD51 was commonly overexpressed in ESCC tissues, suggesting that it is necessary to downregulate RAD51 to achieve high radio- or chemotherapeutic efficacy of ESCC in clinic.
21857994 Data indicate that that the HsRAD51(F129) and HsRAD51(H294) residues are important participants in the cation-induced allosteric activation of HsRAD51.
21810436 Depletion of endogenous Rad51 expression by small interfering Rad51 RNA transfection significantly enhances mitomycin C and/or curcumin induced cell death and cell growth inhibition.
21789034 Findings reveal how sequence variation in the BRC repeats directly affects affinity with RAD51 and provide significant new insights into the control of RAD51 by human BRCA2.
21773671 The Rad51 not only did not protect cells from either telomere instability or celluar effects induced by 360A but was involved in th severe mitotic impairments induced by the G-quadrulpex ligand.
21744352 Elevated expression of Rad51 is associated with esophageal squamous cell carcinoma.
21740187 XPD polymorphism may be a predisposing factor for carcinoma of urinary bladder, but the same cannot be said for RAD51 gene polymorphism.
21732698 SMN-GEMIN2 possessed DNA-binding activity, which was not observed with the GEMIN2 protein, and significantly stimulated the secondary duplex DNA capture by the RAD51-single-stranded DNA complex during homologous pairing
21729596 The XRCC3-C241T variant and the RAD51-G135C homozygote-type significantly increase the risk of the development of acute myeloid leukemia with recurrent chromosome translocation.
21725594 The purpose of the present study was to examine whether five single nucleotide polymorphisms in Rad51 and Xrcc3 exhibited an association with breast cancer susceptibility.
21725251 RAD51 and XRCC3 genes polymorphisms may play an important role in the development of acute myeloid leukemia
21708019 The Rad51 5'UTR 135C>G genotype was associated with mean number of breaks per irradiated lymphoblast in women with BRCA1 mutations but it was not associated with breast cancer risk in a population-based study.
21704413 Our findings showed an association between genetic polymorphisms, XRCC1 c.1196A>G and RAD51 c.-3429 G>C, and the development of radiation-induced toxicities in SCCHN patients.
21670257 propose that the BRC repeats in BRCA2 cooperate in a partially redundant but reinforcing manner to ensure a high probability of RAD51 filament formation
21653319 we postulate that BCR-ABL1 kinase-mediated RAD51(pY315) promotes unfaithful homeologous recombination repair in leukemia cells
21601571 the interaction between BRC repeat 4 (BRC4) and RAD51 was strengthened by the substitution of a single BRC4 amino acid from valine to isoleucine (V1532I).
21501635 RAD51 may function as a universal factor during HR, whereas RAD54 mainly functions in other types of homologous recombination (gene targeting or intra-chromosomal HR), which involves interaction with chromosomal DNA
21486569 Studies indicate that RPA70 SUMOylation serves as a HR mediator to facilitate recruitment of RAD51 to initiate strand invasion.
21464277 cycles of RecA/Rad51 polymerization and dissociation coupled with ATP hydrolysis drives the BM of HJs.
21423218 hsRAD51 protein level is systematically elevated in Barrett's adenocarcinoma (BAC), contributes significantly to genomic evolution during serial propagation of these cells and correlates with disease progression.
21409565 EMSY amplification may mimic BRCA2 deficiency, at least by overriding RPA and PALB2, crippling the BRCA2/RAD51 complex at DNA-damage and replication/transcription sites
21397596 RAD51 G135C polymorphisms are associated with head and neck cancer
21363882 High Rad51 is associated with radioresistance in glioma.
21239234 the recognition of homology and the tolerance of heterology by hRad51 may depend on the local structural motif adopted by the base pairs participating in strand exchange
21176850 Data show that the homozygous variant C/C of RAD51-G135C was found to increase the susceptibility to MDS and the risk of MDS association with structural abnormal karyotype.
21113733 RAD51 and ssDNA interact in overlapping regions; This suggests preferential binding for one partner that could regulate homologous recombination and helps to clarify the role of BLM in maintaining genomic stability.
21110082 RAD51 variant 135C homozygote is associated with elevated breast cancer.
21107697 Distinct differences in the repair process following doxorubicin versus etoposide were seen in concentration dependency, time-course and requirement of Ku70 and Rad51 proteins.
21104022 The 135G>C polymorphism of the RAD51 gene can be an independent marker of colorectal cancer risk.
21103343 Data show that inhibition of BRCA1/BARD1 downregulation is accompanied by the unscheduled recruitment of both proteins to chromatin along with Rad51.
21056573 These results indicate that hRad54 can facilitate hRad51-promoted strand exchange through various degrees of mismatching.
20890127 Rad51 showed the ability to form a complex with the p65 subunit of NFkappaB and regulate the level of p65 interaction with LTR DNA encompassing the kappaB motif.
20871616 PALB2 binds DNA and physically interacts with RAD51 to enhance RAD51's ability to form the D loop. Although PALB2 alone stimulates D-loop formation, it has a cooperative effect with RAD51AP1, an enhancer of RAD51.
20817928 scanning force microscopy imaging was used to determine the architecture of RAD51-DNA complexes involved in strand exchange.
20813000 Meta-analysis of gene-disease association. (HuGE Navigator)
20804747 our data showed that the C722T and the G135C polymorphisms of the XRCC3 and the RAD51 genes might be associated with head and neck squamous cell carcinoma
20804747 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20731661 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20729859 BRCA2 binds to ~6 RAD51 molecules and promotes RAD51 binding to ssDNA coated by replication protein A in a manner that is stimulated by DSS1.
20729858 BRCA2 directs the binding of RAD51 recombinase to ssDNA, reduced the binding of RAD51 to duplex DNA and stimulated RAD51-mediated DNA strand exchange.
20729832 BRCA2 acts by targeting RAD51 to ssDNA over double-stranded DNA, enabling RAD51 to displace replication protein-A (RPA) from ssDNA and stabilizing RAD51-ssDNA filaments by blocking ATP hydrolysis
20713120 Results show that DNA aptamers affect the strand exchange reaction by promoting the dissociation of DNA from the ATP/HsRad51/DNA complex.
20644561 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20640595 RAD51 135G/C polymorphism may be identified as a susceptibility locus for breast cancer [meta-analysis]
20640595 Meta-analysis of gene-disease association. (HuGE Navigator)
20625943 Rad51 expression levels might play an important role in radiation- and chemo-sensitivity of human osteosarcoma.
20623332 meta-analysis suggests that RAD51 variant 135C homozygote is associated with elevated breast cancer risk among BRCA2 mutation carriers
20623332 Meta-analysis of gene-disease association. (HuGE Navigator)
20610542 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20602259 the 135G>C polymorphism of the RAD51 gene, but not the Ser326Cys of the hOGG1 gene, may be linked to endometrial cancer
20602259 Observational study of gene-disease association. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20461453 no evidence for a significant association between the Rad51 single nucleotide polymorphism (135G>C) and breast cancer risk in non-BRCA1/2 mutation carriers
20461453 Meta-analysis of gene-disease association. (HuGE Navigator)
20454923 Meta-analysis suggests that the RAD51 G135C polymorphism is a low-penetrant risk factor for developing breast cancer.
20454923 Meta-analysis of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20413593 human mtDNA is a novel Rad51 substrate; homologous recombination proteins have a role in the maintenance of the human mitochondrial genome
20400964 Observational study of gene-disease association. (HuGE Navigator)
20396943 Meta-analysis suggests the RAD51 135G > C polymorphism may contribute to breast cancer susceptibility.
20396943 Meta-analysis of gene-disease association. (HuGE Navigator)
20373286 Aurora-A expression inhibits RAD51 recruitment to DNA double-strand breaks, decreases double-strand break repair by homologous recombination and sensitizes cancer cells to PARP inhibition.
20368715 Observational study of gene-disease association. (HuGE Navigator)
20358297 The role of the allelic variants in ARLTS1, RAD51 and MDM2 acting in the tumor suppressor, DNA repair and p53 pathways as risk factors for familial breast cancer in 147 patients displaying characteristics of familial disease, was investigated.
20358297 Observational study of gene-disease association. (HuGE Navigator)
20348101 Physical interaction of RECQ5 helicase with RAD51 facilitates its anti-recombinase activity.
20299221 Studies indicate that Rad51 binds to ssDNA and dsDNA with comparable affinities.
20236180 Human SPF45 binds binds to a RAD51 paralog, RAD51B, although it also binds to RAD51 and DMC1 with lower affinity.
20215422 Our results directly implicate BLM in limiting the lethality associated with RAD51 deficiency through the processing of anaphase bridges resulting from the RAD51 defect.
20207730 Ring-shaped Rad51 paralog protein complexes bind Holliday junctions and replication forks as visualized by electron microscopy.
20189471 An important function of XRCC2 is to enhance the activity of RAD51, so that the loss of XRCC2 results in a severe delay in the early response of RAD51 to DNA damage.
20188668 suggest that restart of stalled replication forks and homologous recombination repair of collapsed replication forks require two distinct RAD51-mediated pathways.
20154705 Depletion of PP4R2 impedes homologous recombination (HR) via inefficient loading of the essential HR factor RAD51.
20150366 Observational study of gene-disease association. (HuGE Navigator)
20092964 Overexpression of RAD51, a key component of the homologous DNA repair pathway, is associated with poor breast cancer outcome.
20054644 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20004634 may influence the repair capacity of breast cancer patients and, in turn, confer genetic predisposition to disease
20004634 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20002770 RAD51 protein is strongly expressed in high-grade prostatic cancers, whether sporadic or associated with BRCA germ-line mutations.
19996105 aRPA interacted with both Rad52 and Rad51 and stimulated Rad51 strand exchange.
19960343 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19956565 In the absence of BLM SUMOylation, BLM perturbs RAD51 localization at damaged replication forks and inhibits fork repair by homologous recombination (HR). Conversely, BLM SUMOylation relieves its inhibitory effects on HR, and it promotes RAD51 function.
19952118 Data show that Lamellarin D also exerted a topoisomerase I-mediated DNA damage response resulting in H2AX phosphorylation, and the upregulation of the DNA repair protein Rad51 and of p53.
19914098 There was no association between the RAD51 single nucleotide polymorphism alleles and prostate cancer risk.
19914098 Observational study of gene-disease association. (HuGE Navigator)
19884492 Polymerization and depolymerization of hRad51 on duplex DNA were studied here using a new generation of magnetic tweezers, measuring DNA twist in real time with a resolution of 5 degrees .
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19772428 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19725871 Data found that EVL(222-418) possesses DNA-binding and RAD51-binding activities, and also stimulates RAD51-mediated homologous pairing.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19690177 Observational study of gene-disease association. (HuGE Navigator)
19671671 The successful detection of BRCA1, FANCD2, and RAD51 foci in breast cancer biopsies irradiated ex vivo, is reported.
19661089 Observational study of gene-disease association. (HuGE Navigator)
19632996 Results demonstrate the important role of the RAD51 nucleoprotein filament conformation in stimulation of DNA pairing by BLM.
19628690 BRCA2 targets RAD51 to ssDNA while inhibiting dsDNA binding and that these contrasting activities together bolster one another to stimulate homologous DNA recombination.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19622740 nucleotide hydrolysis by human Rad51 triggers a reversible structural transition leading to filaments with reduced helical pitch.
19606696 The G/C variant of the 135 G/C RAD51 polymorphism may be associated with the increased risk of colorectal cancer development.
19606696 Observational study of gene-disease association. (HuGE Navigator)
19587234 A filament structure of a human Rad51 protein, is reported.
19584272 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
19549356 The combined effect of NQO1C(609T), RAD51(G135C) and XRCC3(C241T) genotypes may promote occurrence of acute lymphoblastic leukemia.
19549356 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19540122 Results suggest that Rad51 binding by the C-terminal Brca2 motif is dispensable for the execution of homologous DNA recombination but instead links the disassembly of Rad51 complexes to mitotic entry.
19536092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19505457 Data show taht emodin at low doses did not affect ERK1/2 activation, mRNA, and Rad51 protein levels; however, it enhanced a gefitinib-induced decrease in phospho-ERK1/2 and Rad51 protein levels by enhancing Rad51 protein instability.
19427856 the phosphorylation of Rad51 Tyr315 stimulates that of Tyr54, which indicates that the phosphorylation of Rad51 by the c-Abl kinase is a sequential process
19426727 Results suggest that the variability of the DNA homologous recombination repair genes RAD51 and XRCC3 may play a role in breast cancer occurrence and progression, but this role may be underlined by a mutual interaction between these genes.
19426727 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19386720 Rad51 and RPA32 are necessary for the completion of EBV lytic infection.
19329439 EVL protein is a novel recombination factor that may be required for repairing specific DNA lesions, and that may cause tumor malignancy by its inappropriate expression.
19303847 Study shows that the solitary BRC4 amino motif of BRCA2 promotes assembly of RAD51 onto single-stranded DNA, but not dsDNA, to stimulate DNA strand exchange.
19285032 phosphorylation on Tyr-315 by c-ABL is required for chromatin association of oligomerization-defective RAD51 mutants, but is insufficient to restore oligomerization.
19275579 K133A RAD51 mutant remains to bind DNA but is unable to form an active nucleofilament due to the poor binding of ATP, which results in the defect on IN inhibition
19253839 No statistical difference the polymorphic distribution of 135G/C in RAD51 gene was observed between breast cancer patients and controls.
19253839 Observational study of gene-disease association. (HuGE Navigator)
19251090 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19214744 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19165339 Mre11 nuclease interacts with Dna2 plus Sgs1 and has a role in Rad51-dependent recombinational repair
19157634 overexpressed in chemo- or radioresistant carcinomas
19150983 FANCJ can inhibit RAD51 strand exchange, an activity that is likely to be important for its role in controlling DNA repair through homologous recombination.
19140342 Human RAD51 protein is essential in the cell proliferation and cell survival.
19133161 DNA molecules into large co-aggregates of RAD52-RAD51-DNA complexes promote RAD51 mediated DNA unwinding reaction.
19124506 Observational study of gene-disease association. (HuGE Navigator)
19122145 real-time assembly and disassembly of human Rad51 nucleoprotein filaments on double-stranded DNA
19117011 the nucleus, nuclear interaction between IRS-1 and Rad51, and the inhibition of recombination.
19116388 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19097142 These data suggest that the assembly of Rad51 into nuclear foci is assisted by association with the nuclear matrix, which may support the spatial organization of the process of repair by homologous recombination.
19092295 Observational study of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
19071013 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19064565 Observational study of gene-disease association. (HuGE Navigator)
19060884 disassembly of human RAD51 nucleoprotein filaments results from the interplay between ATP hydrolysis and the release of the tension stored in the filament
19027952 Frequencies of polymorphic variants of RAD51, XRCC3, NQO1, GSTA1, GSTM1, GSTT1, CYP3A4 and XPD enzymes were similar in patients with MDS and controls.
19027952 Observational study of gene-disease association. (HuGE Navigator)
19010915 AKT1 inhibits homologous recombination by inducing cytoplasmic retention of BRCA1 and RAD51.
19004837 Reversibility, equilibration, and fidelity of strand exchange reaction between short oligonucleotides promoted by RecA protein from escherichia coli and human Rad51 and Dmc1 proteins.
18990028 Observational study of gene-disease association. (HuGE Navigator)
18978339 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18977234 Observational study of gene-disease association. (HuGE Navigator)
18974064 results suggest a contribution of BLM and RAD51 to breast cancer development and provide support for the tumorigenic significance of the functional interaction between these two HR proteins
18974064 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18950845 Observational study of gene-disease association. (HuGE Navigator)
18840682 agonist stimulation of RAD51 promotes the formation of active presynaptic filaments aand resistance to the cross-linking chemotherapeutic drug cisplatin
18834951 RAD51 redistribution to chromatin and nuclear foci formation induced by double-strand breaks and interstrand crosslinks were followed under conditions of TIP49 depletion by RNA interference.
18794841 suggest a model for the vertebrate cell cycle in which homologous DNA recombination during the G2 phase is separated from DNA replication in S phase and chromosome segregation in M
18768166 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18761348 Results describe the mechanism of transfer of the allosteric effect between DNA and ATP binding, conformational changes upon nucleotide binding, and the position of DNA-binding sites for human Rad51.
18756535 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18752184 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18632222 alteration in RAD51 region may contribute to the disturbances of DNA repair involving RAD51 and/or BRCA2 penetration and thus enhance the risk of breast cancer development.
18618591 results indicate that Rad51 can compensate for some aspects of a BRCA2 gene defect and suggest that Rad51 expression levels may be an important modifier of the BRCA2 defective genotype
18617519 Rad51 protein stimulates the branch migration activity of Rad54 protein.(
18581889 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18570881 Rad51 presynaptic filaments are sufficient to locate a homologous sequence and form initial joints, even on the surface of a nucleosome.
18544565 Rad51 protein protects lung cancer cells from synergistic cytotoxic effects induced by gefitinib and chemotherapeutic agents.
18535008 Results indicate that Rad51 and Dmc1 filaments are essentially identical with respect to several structural parameters, including persistence length, helical pitch, filament diameter, DNA base pairs per helical turn and helical handedness.
18439040 caspase 3 cleavage of Rad51 resulted in a functional decrease in Rad51 strand exchange activity and that inhibition of caspase 3 activity increased Rad51 protein levels and Rad51 foci
18429825 Dinucleotide CA repeat polymorphism at RAD51 and BRCA2 gene regions might be associated with genetic susceptibility to breast cancer.
18429825 Observational study of gene-disease association. (HuGE Navigator)
18417535 Identification of a novel hRad51 variant that lacked the sequence corresponding to exon 9 (hRad51-Deltaex9).
18413737 BCCIP-dependent repair of double strand breaks by homologous recombination is an early RAD51 response to ionizing radiation-induced DNA damage.
18317453 Chk1 and Chk2 regulate the functional associations between hBRCA2 and Rad51 in response to DNA damage
18256600 fission yeast (Rhp51) and human (hRad51) RecA homologues promote duplex-duplex DNA-strand exchange in vitro
18203022 germline mutations in RAD51, RAD51AP1, RAD51L1, RAD51L3, RAD52 and RAD54L are unlikely to be causal of an inherited predisposition to CLL.
18173750 the electrostatic environment around position 313 is important for the regulation of the HsRad51 recombinase activity.
18033323 XRCC3 Thr241Met, RAD51 G135C and GSTM1 genotypes did not increase susceptibility to AML when assessed singly, but when XRCC3 and RAD51 genotypes were examined together an increase in susceptibility to AML was seen in children with variant alleles
18033323 Observational study of gene-disease association, gene-gene interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17999359 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17999359 135G-->C may modify the risk of breast cancer in BRCA2 mutation carriers by altering the expression of RAD51.
17947332 The observed preference of hRad51 to form nucleoprotein filaments on double-stranded DNA rather than on single-stranded DNA is due to the fact that it depolymerizes much faster from ssDNA than from dsDNA.
17942895 Overexpression of the homologous recombinase RAD51 in a DT40 BRCA1Delta/Delta mutant rescues defects in proliferation, DNA damage survival, and homologous recombination.
17889711 Observational study of gene-disease association. (HuGE Navigator)
17889711 RAD51 135G>C polymorphism has a role in familial breast cancer in a South American population
17802824 Expression of RAD51 in laryngocarcinoma group was extremely higher than that in of vocal cord polyps. Expression was also related to tumor grade, stage and metastasis.
17761709 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17709342 Real-time kinetics of human RAD51 filament assembly and disassembly on individual molecules of both single- and double-stranded DNA.
17685459 Observational study of gene-disease association. (HuGE Navigator)
17672918 the apparent occurrence of an unusual TG 3' splice site in intron 3 is discussed
17666788 differences in the DNA-binding properties between HsRad51(R150Q) and HsRad51 may be important to account for the tumorigenesis in breast cancer patients with the HsRad51(R150Q) mutation
17639080 bipartite mechanism of Hop2-Mnd1 in homologous DNA pairing: stabilization of the Rad51 presynaptic filament and duplex DNA capture to enhance synaptic complex formation
17616806 the XRCC1 Arg399Gln and RAD51 5'UTR G135C polymorphisms have roles in breast cancer aggressiveness
17591918 BLM, signal transducer 53BP1, and RAD51 interact during stalled replication. Interactions between the three proteins have functional consequences.
17557904 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17549502 The output 3D molecular structure from the combination between BRCA2-RAD51 is derived
17544928 assembly of the Rad51 presynaptic filament represents an obligatory step in the enhancement of the chromatin remodeling reaction
17515904 Interactions of the BRCA2 C-terminal region with RAD51 may facilitate efficient nucleation of RAD51 multimers on DNA and thereby stimulate recombination-mediated repair.
17515903 Productive recombination results from the functional balance between the different RAD51-binding modes of the BRC repeat and exon 27 regions of BRCA2.
17513613 Rad51 has a role in chemoresistance in human soft tissue sarcoma cells along with p53 and activator protein 2 transcriptional regulation
17483448 These results support a model where an interaction with RAD-51 alone is likely involved in filament nucleation, whereas a second independent interaction is involved in stabilization of RAD-51 filaments by BRCA2.
17483304 MSH2 deficient cells irradiation exposure, indicating defective homologous recombinational repair.
17302439 Our data suggest that ATP binding and release without hydrolysis by the K133A mutant protein act as a mechanistic surrogate in a catalytic process that applies to all RecA-like recombinases.
17301259 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17180310 The obtained results indicate that alteration in the RAD51 region may contribute to the disturbances of DNA repair involving RAD51 and BRCA1 and thus enhance the risk of breast cancer development.
17118968 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17118968 The finding that the functional RAD51 172G>T SNP, particularly in the presence of the P53 Arg72Arg genotype, may be a marker of susceptibility to SCCHN needs to be validated by larger studies of different ethnic populations.
17090598 K133A RAD51 mutant remains to bind DNA but is unable to form an active nucleofilament due to the poor binding of ATP, which results in the defect on IN inhibition
17078101 Observational study of gene-disease association. (HuGE Navigator)
17063276 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17007294 Observational study of gene-disease association. (HuGE Navigator)
17001309 Hypoxia induces substantial p130 dephosphorylation and nuclear accumulation, leading to the formation of E2F4/p130 complexes and increased occupancy of E2F4 and p130 at the RAD51 and BRCA1 promoters.
16983346 K133A RAD51 mutant remains to bind DNA but is unable to form an active nucleofilament due to the poor binding of ATP, which results in the defect on IN inhibition
16979659 Results demonstrate that the L1-loop of Rad51 plays a crucial role in the assembly of extended nucleoprotein filaments on dsDNA, but the N-terminal domain and the L2 DNA-binding loop have significantly less impact on this process.
16902145 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16890287 Observational study of gene-disease association. (HuGE Navigator)
16890287 These data suggest that variants in the RAD51 HR gene may modulate genetic predisposition to acute myeloid leukaemia(AML).
16843501 Observational study of gene-disease association. (HuGE Navigator)
16837909 Observational study of gene-disease association. (HuGE Navigator)
16837909 The G/C polymorphism of the RAD51 gene may not be directly involved in the development and=or progression of breast cancer.
16723430 Rad51, shows a preference for binding to single-stranded DNA sequences primarily rich in G-residues and poor in A- and C-residues.
16644292 salt-induced characteristics of hRAD51 increasingly resemble RecA-mediated recombinase activities
16638864 Observational study of gene-disease association. (HuGE Navigator)
16629903 The association of Rad51 with the nuclear matrix correlates with the formation of Rad51 nuclear foci as a result of DNA damage
16624636 Mg2+ influences the discrimination and release of ADP, which may sequentially impose an important regulatory step in the hRAD51 ATPase cycle
16624550 Observational study of gene-disease association. (HuGE Navigator)
16596227 RAD51 expression levels may influence the outcome of patients with head and neck cancer treated with chemotherapy and radiotherapy.
16516153 We suggest that p53 has a role in RAD51 clearance post DSB repair and that nucleoli might be sites of RAD51 protein degradation.
16511829 K133A RAD51 mutant remains to bind DNA but is unable to form an active nucleofilament due to the poor binding of ATP, which results in the defect on IN inhibition
16477874 Observational study of gene-disease association. (HuGE Navigator)
16475125 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16432240 analysis of lateral diffusion of human Rad51 on double-stranded DNA
16427610 Rad51 regulates expression of genes involved in actin remodelling
16398215 three cis-sequence elements in the Rad51 transcriptional promoter may help explain high-level expression of Rad51 in a variety of solid tumours
16395335 RAD51C ensures a tight regulation of RAD51 assembly during DSB repair and plays a direct role in repairing DSBs in vivo.
16367760 DNA-induced disassembly of higher-order forms of Rad51 and Rad52 proteins as steps that precede protein assembly during hRad51 presynapsis on DNA, in vitro.
16261408 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16261408 Because mutations in BRCA1 and BRCA2 may be directly linked with breast cancer, genetic variations in the BRCA2 and RAD51 genes may be believed to play a role in this disease.
16215984 We have made the unexpected observation that Rad51 degradation via the ubiquitin-mediated proteasome pathway occurs as a natural part of recombinational DNA repair.
16186822 MDC1 functions in Rad51-mediated homologous recombination by retaining Rad51 in chromatin.
16018971 These results help us to model important mechanistic steps of hRad51 presynapsis on ssDNA templates.
15965906 Data show that JC polyomavirus T-antigen inhibits homologous recombination DNA repair by binding insulin receptor substrate 1, which then translocates to the nucleus and binds Rad51 at the site of damaged DNA.
15958648 Observational study of gene-disease association. (HuGE Navigator)
15944450 Rad51 forms regular stable filaments with extended double-stranded DNA in conditions that promote an efficient in vitro strand exchange reaction.
15766559 purified hRad51 and hRad52 interact with each other as well as with Mini chromosome maintenance (MCM) proteins in HeLa cell extracts
15750625 BLM collaborates with RAD51 to facilitate recombination repair and promotes the resistance of BCR/ABL-positive leukemia cells to DNA-damaging agents.
15734952 Observational study of gene-disease association. (HuGE Navigator)
15671039 FANCD2 mediates double strand DNA break repair independently of BRCA2- and Rad51-associated homologous recombination
15611070 Rad51 binds at a promiscuous, highly electrostatic binding site in p53
15466868 Rad54 protein serves as a dsDNA gateway for the Rad51-ssDNA filament, promoting binding and an ATP hydrolysis-dependent translocation of dsDNA during the search for homologous sequences
15330855 Mutational analyses of the human Rad51-Tyr315 residue indicates an important role of Tyr315 residue in ssDNA binding and DNA filament formation.
15313891 Observational study of gene-disease association. (HuGE Navigator)
15226506 a crucial role of the ATPase activity in regulation of DNA strand exchange activity of hRad51 protein.
15165851 investigation of the role of tyrosine 315 by comparing the three-dimensional structures of human Rad51 and its prokaryotic homologue, Escherichia coli RecA
15138485 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15123651 ADP/ATP processing and strand exchange by hRAD51 is enhanced by hXRCC2
15102670 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15095978 results establish a direct functional link between p53 and Rad51, and reveal that one of p53's functions in genome stabilization may be to prevent detrimental genome rearrangements promoted by Rad51
15036125 Observational study of gene-disease association. (HuGE Navigator)
14755242 K133A RAD51 mutant remains to bind DNA but is unable to form an active nucleofilament due to the poor binding of ATP, which results in the defect on IN inhibition
14724582 link between elevated Rad51 protein levels, genome instability, and tumor progression
14599770 Rad51 is involved in the signalling and repair of DNA damage--REVIEW
12917330 exogenous nuclease-defective FEN-1 causes repeat instability and aberrant DNA repair. Inefficient flap processing blocks the formation of Rad51/BRCA1 complexes but invokes repair by other pathways
12883740 Observational study of gene-disease association. (HuGE Navigator)
12826751 Ectopic expression of the recombination protein Rad51 can protect cells from radiation-induced translocations.
12750285 p53 interacts with hRAD51 and hRAD54, and directly modulates homologous recombination.
12750242 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12673366 Observational study of gene-disease association. (HuGE Navigator)
12673366 study implies that the G/C polymorphism of the RAD51 gene may not be directly involved in the development and/or progression of breast cancer and so it may not be useful as an independent marker in this disease
12650908 In conclusion, effective and prompt IR-induced Rad51 focus formation is cell cycle-regulated and requires both ATM and c-Abl.
12606939 S-phase RAD51 foci form normally in CAPAN-1 cells expressing truncated BRCA2. Moreover, we find that RAD51 specifically associates with chromatin at S phase in a reaction that is BRCA2-independent.
12442171 crystal structure of a complex between an evolutionarily conserved sequence in BRCA2 (the BRC repeat) and the RecA-homology domain of RAD51
12242278 physiological role for the WRN RecQ helicase protein in RAD51-dependent homologous recombination
12239151 interacts with FANCD2 in S phase cell lines
12226092 association of oligomeric state with biochemical function
12205100 involved in homologous DNA pairing
12036913 Observational study of gene-disease association. (HuGE Navigator)
12023982 Observational study of gene-disease association. (HuGE Navigator)
11935313 autoantibody screening indicates Rad51 is a tumor-associated antigen in pancreatic adenocarcinoma
11867550 TGFbeta can promote DNA instability through down-regulation of Rad51 and inhibition of DNA repair.
11839741 modulation of DNA binding by adenosine nucleotides
11839740 binding and ATPPase inhibition by adenine nucleotides
11839739 biochemical characterization by ATP hydrolysis
11809887 differential effects of overexpression on gene targeting and extrachromosomal homologous recombination in a human tumor cell line
11782381 Elevated levels of Rad51 recombination protein in tumor cells.
11691922 reduces double-strand break-induced homologous recombination with overexpression in mammalian cells
11580245 molecular evolution
11535547 Observational study of gene-disease association. (HuGE Navigator)
11248061 Observational study of gene-gene interaction. (HuGE Navigator)
9121429 K133A RAD51 mutant remains to bind DNA but is unable to form an active nucleofilament due to the poor binding of ATP, which results in the defect on IN inhibition

AA Sequence

MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAK      1 - 70
ADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTL     71 - 140
AVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAM    141 - 210
MVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFA    211 - 280
ADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD               281 - 339
//

Text Mined References (474)

PMID Year Title
26990772 2016 A Hypomorphic PALB2 Allele Gives Rise to an Unusual Form of FA-N Associated with Lymphoid Tumour Development.
26811421 2016 TOPBP1 regulates RAD51 phosphorylation and chromatin loading and determines PARP inhibitor sensitivity.
26752698 2016 Gefitinib Synergizes with Irinotecan to Suppress Hepatocellular Carcinoma via Antagonizing Rad51-Mediated DNA-Repair.
26699641 2015 Homologous Recombination Repair Factors Rad51 and BRCA1 Are Necessary for Productive Replication of Human Papillomavirus 31.
26681308 2015 A novel Fanconi anaemia subtype associated with a dominant-negative mutation in RAD51.
26676960 2016 Expression of DNA double-strand break repair proteins predicts the response and prognosis of colorectal cancer patients undergoing oxaliplatin-based chemotherapy.
26650628 2016 Homozygous T172T and Heterozygous G135C Variants of Homologous Recombination Repairing Protein RAD51 are Related to Sporadic Breast Cancer Susceptibility.
26627254 2015 Rad51 recombinase prevents Mre11 nuclease-dependent degradation and excessive PrimPol-mediated elongation of nascent DNA after UV irradiation.
26511493 2016 Association between RAD 51 rs1801320 and susceptibility to glioblastoma.
26507587 2016 Interactions between RAD51 rs1801321 and maternal cigarette smoking as risk factor for nonsyndromic cleft lip with or without cleft palate.
26406958 2015 Impact of RAD51 G135C and XRCC1 Arg399Gln polymorphisms on ovarian carcinoma risk in Serbian women.
26339569 2015 Polymorphisms of homologous recombination RAD51, RAD51B, XRCC2, and XRCC3 genes and the risk of prostate cancer.
26323318 2015 NUCKS1 is a novel RAD51AP1 paralog important for homologous recombination and genome stability.
26253028 2015 A Dominant Mutation in Human RAD51 Reveals Its Function in DNA Interstrand Crosslink Repair Independent of Homologous Recombination.
26166705 2015 BOD1L Is Required to Suppress Deleterious Resection of Stressed Replication Forks.
26133502 2015 Nrf2 facilitates repair of radiation induced DNA damage through homologous recombination repair pathway in a ROS independent manner in cancer cells.
26123175 2015 hCAS/CSE1L regulates RAD51 distribution and focus formation for homologous recombinational repair.
26119522 2016 RAD51 G135C genetic polymorphism and their potential role in gastric cancer induced by Helicobacter pylori infection in Bhutan.
26108708 2015 RAD51 135G>C substitution increases breast cancer risk in an ethnic-specific manner: a meta-analysis on 21,236 cases and 19,407 controls.
26088134 2015 Functional Relationship of ATP Hydrolysis, Presynaptic Filament Stability, and Homologous DNA Pairing Activity of the Human Meiotic Recombinase DMC1.
25813273 2015 Congenital mirror movements: phenotypes associated with DCC and RAD51 mutations.
25765654 2015 RAD54 family translocases counter genotoxic effects of RAD51 in human tumor cells.
25753674 2015 Involvement of ATM in homologous recombination after end resection and RAD51 nucleofilament formation.
25743260 2015 Single Nucleotide Polymorphisms (SNPs) of RAD51-G172T and XRCC2-41657C/T Homologous Recombination Repair Genes and the Risk of Triple- Negative Breast Cancer in Polish Women.
25733714 2015 Rad51-mediated replication fork reversal is a global response to genotoxic treatments in human cells.
25642963 2015 Homologous-recombination-deficient tumours are dependent on Pol?-mediated repair.
25640309 2015 Systematic identification of molecular links between core and candidate genes in breast cancer.
25617833 2015 Human DNA helicase B functions in cellular homologous recombination and stimulates Rad51-mediated 5'-3' heteroduplex extension in vitro.
25612937 2015 Genetic variants of the DNA damage repair genes XRCC4 and RAD51 are associated with susceptibility to esophageal cancer.
25585578 2015 FBH1 influences DNA replication fork stability and homologous recombination through ubiquitylation of RAD51.
25556492 2014 Association of RAD 51 135 G/C, 172 G/T and XRCC3 Thr241Met gene polymorphisms with increased risk of head and neck cancer.
25556451 2014 Correlation between selected XRCC2, XRCC3 and RAD51 gene polymorphisms and primary breast cancer in women in Pakistan.
25542228 2015 Genetic polymorphisms of DNA repair pathways influence the response to chemotherapy and overall survival of gastric cancer.
25539919 2015 Tumor-associated mutations in a conserved structural motif alter physical and biochemical properties of human RAD51 recombinase.
25499220 2014 Elevated estrogen receptor-? in VHL-deficient condition induces microtubule organizing center amplification via disruption of BRCA1/Rad51 interaction.
25417706 2015 Rad18 and Rnf8 facilitate homologous recombination by two distinct mechanisms, promoting Rad51 focus formation and suppressing the toxic effect of nonhomologous end joining.
25395584 2015 BRG1 promotes the repair of DNA double-strand breaks by facilitating the replacement of RPA with RAD51.
25365323 2014 Rad51 and Rad52 are involved in homologous recombination of replicating herpes simplex virus DNA.
25354554 2015 The RAD51 135G>C polymorphism is related to the effect of adjuvant therapy in early breast cancer.
25310191 2014 Rad51 activates polyomavirus JC early transcription.
25288749 2014 Visualization and quantification of nascent RAD51 filament formation at single-monomer resolution.
25282148 2014 Structure and mechanism of action of the BRCA2 breast cancer tumor suppressor.
25175062 2014 Inhibition of autophagy enhances the radiosensitivity of nasopharyngeal carcinoma by reducing Rad51 expression.
25110436 2014 RAD51 potentiates synergistic effects of chemotherapy with PCI-24781 and cis-diamminedichloroplatinum on gastric cancer.
25035396 2014 Mutant IDH1-driven cellular transformation increases RAD51-mediated homologous recombination and temozolomide resistance.
24948741 2014 DNA double-strand break repair genes and oxidative damage in brain metastasis of breast cancer.
24930116 2014 Association of polymorphisms in the 5' untranslated region of RAD51 gene with risk of endometrial cancer in the Polish population.
24927671 2014 An increased risk of ovarian cancer associated with polymorphism in BRCC5 gene in Caucasian populations.
24871558 2014 RAD51 G135C gene polymorphism and risk of colorectal cancer in Kashmir.
24859942 2014 Genetic 135G/C polymorphism of RAD51 gene and risk of cancer: a meta-analysis of 28,956 cases and 28,372 controls.
24847939 2014 Interplay of Rad51 with NF-?B pathway stimulates expression of HIV-1.
24811120 2014 Rad51 supports triple negative breast cancer metastasis.
24808016 2014 Congenital mirror movements: mutational analysis of RAD51 and DCC in 26 cases.
24781030 2014 Regulation of Rad51 promoter.
24708616 2014 Gene expression profiling reveals activation of the FA/BRCA pathway in advanced squamous cervical cancer with intrinsic resistance and therapy failure.
24662483 2014 Ago2 facilitates Rad51 recruitment and DNA double-strand break repair by homologous recombination.
24616504 2014 Protective role of miR-155 in breast cancer through RAD51 targeting impairs homologous recombination after irradiation.
24599673 2014 The effect of RAD51 135 G>C and XRCC2 G>A (rs3218536) polymorphisms on ovarian cancer risk among Caucasians: a meta-analysis.
24583581 2014 Nascent DNA synthesis during homologous recombination is synergistically promoted by the rad51 recombinase and DNA homology.
24576846 2014 Modulation of homology-directed repair in T98G glioblastoma cells due to interactions between wildtype p53, Rad51 and HCMV IE1-72.
24568492 2014 Equivocal association of RAD51 polymorphisms with risk of esophageal squamous cell carcinoma in a Chinese population.
24550317 2014 PARP1-dependent recruitment of KDM4D histone demethylase to DNA damage sites promotes double-strand break repair.
24525463 2014 Downregulation of Rad51 participates in OTA-induced DNA double-strand breaks in GES-1 cells in vitro.
24457040 2014 RAD51 Gene 135G/C polymorphism and the risk of four types of common cancers: a meta-analysis.
24375044 2013 Association between polymorphisms of the DNA repair gene RAD51 and ovarian cancer.
24244429 2013 Panobinostat enhances cytarabine and daunorubicin sensitivities in AML cells through suppressing the expression of BRCA1, CHK1, and Rad51.
24223453 2013 Polymorphisms of the homologous recombination gene RAD51 in keratoconus and Fuchs endothelial corneal dystrophy.
24189466 2013 Common gene variants in RAD51, XRCC2 and XPD are not associated with clinical outcome in soft-tissue sarcoma patients.
24141787 2014 Breast cancer-associated missense mutants of the PALB2 WD40 domain, which directly binds RAD51C, RAD51 and BRCA2, disrupt DNA repair.
24114315 2014 RAD51 135G>C and TP53 Arg72Pro polymorphisms and susceptibility to breast cancer in Serbian women.
24108124 2013 FBH1 helicase disrupts RAD51 filaments in vitro and modulates homologous recombination in mammalian cells.
24088786 2013 Systematic screen identifies miRNAs that target RAD51 and RAD51D to enhance chemosensitivity.
24065387 2014 Rad51 expression is a useful predictive factor for the efficacy of neoadjuvant chemoradiotherapy in squamous cell carcinoma of the esophagus.
24056534 2013 RAD51 deficiency disrupts the corticospinal lateralization of motor control.
24046452 2013 Activation of the SUMO modification system is required for the accumulation of RAD51 at sites of DNA damage.
24040396 2013 Association between the RAD51 135 G>C polymorphism and risk of cancer: a meta-analysis of 19,068 cases and 22,630 controls.
24013206 2013 A cancer-associated BRCA2 mutation reveals masked nuclear export signals controlling localization.
24005565 2013 Human DNA helicase HELQ participates in DNA interstrand crosslink tolerance with ATR and RAD51 paralogs.
23978154 2014 Genetic polymorphisms of RAD51 and XRCC3 and acute myeloid leukemia risk: a meta-analysis.
23977219 2013 XRCC3 and RAD51 expression are associated with clinical factors in breast cancer.
23955800 2014 Association between RAD51 gene polymorphism (-135G/C) and susceptibility of myelodysplastic syndrome and acute leukemia: evidence based on a meta-analysis.
23868022 2013 RAD51 gene is associated with advanced age-related macular degeneration in Chinese population.
23810717 2013 The HsRAD51B-HsRAD51C stabilizes the HsRAD51 nucleoprotein filament.
23801766 2013 Combined optical and topographic imaging reveals different arrangements of human RAD54 with presynaptic and postsynaptic RAD51-DNA filaments.
23757189 2013 ATP-dependent nucleosome unwrapping catalyzed by human RAD51.
23754376 2013 FIGNL1-containing protein complex is required for efficient homologous recombination repair.
23678008 2013 p53 suppresses BRCA2-stimulated ATPase and strand exchange functions of human RAD51.
23625599 2013 RAD51 genotype and triple-negative breast cancer (TNBC) risk in Polish women.
23591384 2013 Human Rad51 promotes mitochondrial DNA synthesis under conditions of increased replication stress.
23570471 2013 DNA repair and cytotoxic drugs: the potential role of RAD51 in clinical outcome of non-small-cell lung cancer patients.
23509288 2013 Scaffolding protein SPIDR/KIAA0146 connects the Bloom syndrome helicase with homologous recombination repair.
23404160 2013 BLM and RAD51 genes polymorphism and susceptibility to breast cancer.
23401855 2013 The MCM8-MCM9 complex promotes RAD51 recruitment at DNA damage sites to facilitate homologous recombination.
23393192 2013 Single-molecule sorting reveals how ubiquitylation affects substrate recognition and activities of FBH1 helicase.
23341130 2013 A novel small molecule RAD51 inactivator overcomes imatinib-resistance in chronic myeloid leukaemia.
23318456 2013 Reduced FANCD2 influences spontaneous SCE and RAD51 foci formation in uveal melanoma and Fanconi anaemia.
23300655 2012 RAD51 and breast cancer susceptibility: no evidence for rare variant association in the Breast Cancer Family Registry study.
23285190 2012 CBP and p300 histone acetyltransferases contribute to homologous recombination by transcriptionally activating the BRCA1 and RAD51 genes.
23266955 2012 The chromatin remodeler p400 ATPase facilitates Rad51-mediated repair of DNA double-strand breaks.
23161237 2012 RAD51 gene polymorphisms and sporadic colorectal cancer risk in Poland.
23149936 2013 Rad51 paralog complexes BCDX2 and CX3 act at different stages in the BRCA1-BRCA2-dependent homologous recombination pathway.
23091899 2012 A single nucleotide polymorphism in the 5' untranslated region of RAD51 and ovarian cancer risk in Polish women.
23065657 2013 RAD51 overexpression is a negative prognostic marker for colorectal adenocarcinoma.
23065228 2013 RAD51 polymorphisms and breast cancer risk.
22935458 2012 Lack of association between the 135G/C RAD51 gene polymorphism and the risk of colorectal cancer among Polish population.
22865450 2012 RNF8 regulates assembly of RAD51 at DNA double-strand breaks in the absence of BRCA1 and 53BP1.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22789542 2012 A distinct replication fork protection pathway connects Fanconi anemia tumor suppressors to RAD51-BRCA1/2.
22778135 2012 RAD51 mutants cause replication defects and chromosomal instability.
22729783 2012 Suberoylanilide hydroxamic acid as a radiosensitizer through modulation of RAD51 protein and inhibition of homology-directed repair in multiple myeloma.
22645136 2012 A variant of the breast cancer type 2 susceptibility protein (BRC) repeat is essential for the RECQL5 helicase to interact with RAD51 recombinase for genome stabilization.
22641345 2012 Nucleostemin prevents telomere damage by promoting PML-IV recruitment to SUMOylated TRF1.
22634097 2012 Role of the RAD51 G172T polymorphism in the clinical outcome of cervical cancer patients under concomitant chemoradiotherapy.
22613844 2012 Genetic variability of Xrcc3 and Rad51 modulates the risk of head and neck cancer.
22611952 2012 The association between polymorphisms of the RAD51-G135C, XRCC2-Arg188His and XRCC3-Thr241Met genes and clinico-pathologic features in breast cancer in Poland.
22587838 2012 HSF4 is involved in DNA damage repair through regulation of Rad51.
22580645 2012 Evaluation of relation of RAD51 and the effect of chemo-radiation therapy for advanced rectal cancer.
22487057 2012 Single nucleotide polymorphisms of RAD51 G135C, XRCC2 Arg188His and XRCC3 Thr241Met homologous recombination repair genes and the risk of sporadic endometrial cancer in Polish women.
22362735 2012 Ca2+ improves organization of single-stranded DNA bases in human Rad51 filament, explaining stimulatory effect on gene recombination.
22325354 2012 Plk1 and CK2 act in concert to regulate Rad51 during DNA double strand break repair.
22305526 2012 RAD51 haploinsufficiency causes congenital mirror movements in humans.
22293751 2012 APRIN is a cell cycle specific BRCA2-interacting protein required for genome integrity and a predictor of outcome after chemotherapy in breast cancer.
22275364 2012 RAD51 protein ATP cap regulates nucleoprotein filament stability.
22274865 2012 Methotrexate-mediated inhibition of RAD51 expression and homologous recombination in cancer cells.
22193777 2012 ChAM, a novel motif that mediates PALB2 intrinsic chromatin binding and facilitates DNA repair.
22174876 2011 Adenoviral vector driven by a minimal Rad51 promoter is selective for p53-deficient tumor cells.
22153967 2012 Inhibition of homologous recombination by the PCNA-interacting protein PARI.
22116401 2011 Synaptonemal complex protein SYCP3 impairs mitotic recombination by interfering with BRCA2.
22102073 2011 135G>C and 172G>T polymorphism in the 5' untranslated region of RAD51 and sporadic endometrial cancer risk in Polish women.
22013044 2012 Stimulation of the human RAD51 nucleofilament restricts HIV-1 integration in vitro and in infected cells.
21998700 2011 Functional connection between Rad51 and PML in homology-directed repair.
21987080 2011 Haplotypes of DNA repair and cell cycle control genes, X-ray exposure, and risk of childhood acute lymphoblastic leukemia.
21965664 2011 hSWS1·SWSAP1 is an evolutionarily conserved complex required for efficient homologous recombination repair.
21926087 2011 RAD51 can inhibit PDGF-B-induced gliomagenesis and genomic instability.
21915862 2011 Lack of association of RAD51 genetic variations with hepatitis B virus clearance and occurrence of hepatocellular carcinoma in a Korean population.
21903585 2011 RAD51-associated protein 1 (RAD51AP1) interacts with the meiotic recombinase DMC1 through a conserved motif.
21858113 2011 Berberine radiosensitizes human esophageal cancer cells by downregulating homologous recombination repair protein RAD51.
21857994 2011 Subunit interface residues F129 and H294 of human RAD51 are essential for recombinase function.
21810436 2011 Curcumin enhances the mitomycin C-induced cytotoxicity via downregulation of MKK1/2-ERK1/2-mediated Rad51 expression in non-small cell lung cancer cells.
21789034 2011 Interrogation of the protein-protein interactions between human BRCA2 BRC repeats and RAD51 reveals atomistic determinants of affinity.
21773671 2012 Rad51 and DNA-PKcs are involved in the generation of specific telomere aberrations induced by the quadruplex ligand 360A that impair mitotic cell progression and lead to cell death.
21744352 2011 Elevated expression of Rad51 is correlated with decreased survival in resectable esophageal squamous cell carcinoma.
21740187 2012 Susceptibility of XPD and RAD51 genetic variants to carcinoma of urinary bladder in North Indian population.
21732698 2011 Purification of the human SMN-GEMIN2 complex and assessment of its stimulation of RAD51-mediated DNA recombination reactions.
21729596 2011 [Relationship between RAD51-G135C/XRCC3-C241T polymorphisms and development of acute myeloid leukemia with recurrent chromosome translocation].
21725594 Combined effect of polymorphisms in Rad51 and Xrcc3 on breast cancer risk and chromosomal radiosensitivity.
21725251 2011 RAD51 and XRCC3 gene polymorphisms and the risk of developing acute myeloid leukemia.
21708019 2011 Association of Rad51 polymorphism with DNA repair in BRCA1 mutation carriers and sporadic breast cancer risk.
21704413 2011 Association between single nucleotide polymorphisms in the XRCC1 and RAD51 genes and clinical radiosensitivity in head and neck cancer.
21670257 2011 Two classes of BRC repeats in BRCA2 promote RAD51 nucleoprotein filament function by distinct mechanisms.
21653319 2011 Targeting RAD51 phosphotyrosine-315 to prevent unfaithful recombination repair in BCR-ABL1 leukemia.
21601571 2011 Valine 1532 of human BRC repeat 4 plays an important role in the interaction between BRCA2 and RAD51.
21501635 2011 Over-expression of RAD51 or RAD54 but not RAD51/4 enhances extra-chromosomal homologous recombination in the human sarcoma (HT-1080) cell line.
21486569 2011 SUMOylation and de-SUMOylation in response to DNA damage.
21464277 2011 The RecA/RAD51 protein drives migration of Holliday junctions via polymerization on DNA.
21423218 2011 Genomic evolution in Barrett's adenocarcinoma cells: critical roles of elevated hsRAD51, homologous recombination and Alu sequences in the genome.
21409565 2011 EMSY overexpression disrupts the BRCA2/RAD51 pathway in the DNA-damage response: implications for chromosomal instability/recombination syndromes as checkpoint diseases.
21399666 2011 A mitotic function for the high-mobility group protein HMG20b regulated by its interaction with the BRC repeats of the BRCA2 tumor suppressor.
21397596 2011 Association of XRCC3 C722T and RAD51 G135C polymorphisms with head and neck cancer susceptibility in a Polish population.
21363882 2011 Rad51 inhibition is an effective means of targeting DNA repair in glioma models and CD133+ tumor-derived cells.
21276791 2011 Homologous recombination proteins are associated with centrosomes and are required for mitotic stability.
21252223 2011 The role of the human SWI5-MEI5 complex in homologous recombination repair.
21239234 2011 Heterology tolerance and recognition of mismatched base pairs by human Rad51 protein.
21176850 2011 Detoxification and DNA repair genes polymorphisms and susceptibility of primary myelodysplastic syndromes in Chinese population.
21113733 2011 Critical interaction domains between bloom syndrome protein and RAD51.
21110082 2011 New conflicting results obtained in the subgroup analysis of RAD51 135G>C polymorphism and breast cancer risk.
21107697 2011 Ku70 and Rad51 vary in their importance for the repair of doxorubicin- versus etoposide-induced DNA damage.
21104022 2011 Polymorphisms in RAD51, XRCC2 and XRCC3 genes of the homologous recombination repair in colorectal cancer--a case control study.
21103343 2010 PI 3 kinase related kinases-independent proteolysis of BRCA1 regulates Rad51 recruitment during genotoxic stress in human cells.
21076401 2010 BRCA2 acts as a RAD51 loader to facilitate telomere replication and capping.
21056573 2011 From strand exchange to branch migration; bypassing of non-homologous sequences by human Rad51 and Rad54.
20890127 2010 Activation of HIV-1 LTR by Rad51 in microglial cells.
20871616 2010 Enhancement of RAD51 recombinase activity by the tumor suppressor PALB2.
20871615 2010 Cooperation of breast cancer proteins PALB2 and piccolo BRCA2 in stimulating homologous recombination.
20817928 2011 Visualizing RAD51-mediated joint molecules: implications for recombination mechanism and the effect of sequence heterology.
20813000 2010 Polymorphisms in DNA repair genes and risk of non-Hodgkin lymphoma in a pooled analysis of three studies.
20804747 2010 Polymorphisms of the XRCC3 C722T and the RAD51 G135C genes and the risk of head and neck cancer in a Polish population.
20731661 2010 Comprehensive analysis of DNA repair gene polymorphisms and survival in patients with early stage non-small-cell lung cancer.
20729859 2010 Human BRCA2 protein promotes RAD51 filament formation on RPA-covered single-stranded DNA.
20729858 2010 The breast cancer tumor suppressor BRCA2 promotes the specific targeting of RAD51 to single-stranded DNA.
20729832 2010 Purified human BRCA2 stimulates RAD51-mediated recombination.
20713120 2010 Targeting human Rad51 by specific DNA aptamers induces inhibition of homologous recombination.
20705237 2010 Regulation of DNA repair through deSUMOylation and SUMOylation of replication protein A complex.
20644561 2011 A large-scale candidate gene approach identifies SNPs in SOD2 and IL13 as predictive markers of response to preoperative chemoradiation in rectal cancer.
20640595 2011 RAD51 135G/C polymorphism and breast cancer risk: a meta-analysis from 21 studies.
20625943 2011 Knockdown of Rad51 expression induces radiation- and chemo-sensitivity in osteosarcoma cells.
20623332 2011 RAD51 135G>C polymorphism and breast cancer risk: a meta-analysis.
20610542 2010 Gamma-radiation sensitivity and polymorphisms in RAD51L1 modulate glioma risk.
20602259 2011 DNA damage and repair in endometrial cancer in correlation with the hOGG1 and RAD51 genes polymorphism.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20461453 2011 RAD51 135G>C does not modify breast cancer risk in non-BRCA1/2 mutation carriers: evidence from a meta-analysis of 12 studies.
20454923 2011 RAD51 G135C polymorphism is associated with breast cancer susceptibility: a meta-analysis involving 22,399 subjects.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20413593 2010 Discovery of a novel function for human Rad51: maintenance of the mitochondrial genome.
20400964 2010 Germline mutations in breast and ovarian cancer pedigrees establish RAD51C as a human cancer susceptibility gene.
20396943 2010 RAD51 135G>C polymorphism contributes to breast cancer susceptibility: a meta-analysis involving 26,444 subjects.
20373286 2010 Aurora-A expressing tumour cells are deficient for homology-directed DNA double strand-break repair and sensitive to PARP inhibition.
20368715 2011 Tumor response is predicted by patient genetic profile in rectal cancer patients treated with neo-adjuvant chemo-radiotherapy.
20358297 2011 ARLTS1, MDM2 and RAD51 gene variations are associated with familial breast cancer.
20348101 2010 Physical interaction of RECQ5 helicase with RAD51 facilitates its anti-recombinase activity.
20299221 2010 Single-molecule imaging brings Rad51 nucleoprotein filaments into focus.
20236180 2010 Holliday junction-binding activity of human SPF45.
20231364 2010 RecQL5 promotes genome stabilization through two parallel mechanisms--interacting with RNA polymerase II and acting as a helicase.
20215422 2010 The Bloom syndrome protein limits the lethality associated with RAD51 deficiency.
20207730 2010 Ring-shaped Rad51 paralog protein complexes bind Holliday junctions and replication forks as visualized by electron microscopy.
20189471 2010 The importance of XRCC2 in RAD51-related DNA damage repair.
20188668 2010 Hydroxyurea-stalled replication forks become progressively inactivated and require two different RAD51-mediated pathways for restart and repair.
20154705 2010 A PP4 phosphatase complex dephosphorylates RPA2 to facilitate DNA repair via homologous recombination.
20150366 2010 DNA repair gene polymorphisms and risk of adult meningioma, glioma, and acoustic neuroma.
20092964 2010 DNA repair gene expression and risk of locoregional relapse in breast cancer patients.
20054644 2010 Variants in DNA double-strand break repair genes and risk of familial breast cancer in a South American population.
20004634 2010 Breast cancer risk and common single nucleotide polymorphisms in homologous recombination DNA repair pathway genes XRCC2, XRCC3, NBS1 and RAD51.
20002770 2009 Overexpression of RAD51 occurs in aggressive prostatic cancer.
19996105 2010 An alternative form of replication protein a expressed in normal human tissues supports DNA repair.
19995904 2010 DNA polymerase POLN participates in cross-link repair and homologous recombination.
19960343 2010 Influence of DNA repair RAD51 gene variants in overall survival of non-small cell lung cancer patients treated with first line chemotherapy.
19956565 2009 SUMO modification regulates BLM and RAD51 interaction at damaged replication forks.
19952118 2009 Essential role of mitochondria in apoptosis of cancer cells induced by the marine alkaloid Lamellarin D.
19914098 DNA repair gene polymorphisms and prostate cancer risk in South Australia--results of a pilot study.
19884492 2009 Direct observation of twisting steps during Rad51 polymerization on DNA.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19783859 2009 Cellular redistribution of Rad51 in response to DNA damage: novel role for Rad51C.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19772428 2009 Association of polymorphisms in genes of the homologous recombination DNA repair pathway and thyroid cancer risk.
19725871 2009 Biochemical analysis of the human EVL domains in homologous recombination.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690177 2009 Polymorphic variants in hereditary pancreatic cancer genes are not associated with pancreatic cancer risk.
19671671 2009 Utility of DNA repair protein foci for the detection of putative BRCA1 pathway defects in breast cancer biopsies.
19661089 2009 Genetic variation in immune regulation and DNA repair pathways and stomach cancer in China.
19632996 2009 Bloom syndrome helicase stimulates RAD51 DNA strand exchange activity through a novel mechanism.
19628690 2009 The BRC repeats of human BRCA2 differentially regulate RAD51 binding on single- versus double-stranded DNA to stimulate strand exchange.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19622740 2009 Structural transitions within human Rad51 nucleoprotein filaments.
19606696 2009 [The role of RAD 51 gene polymorphism in patients with colorectal cancer in the Polish subpopulation].
19587234 2009 Structure of human Rad51 protein filament from molecular modeling and site-specific linear dichroism spectroscopy.
19584272 2009 Modification of ovarian cancer risk by BRCA1/2-interacting genes in a multicenter cohort of BRCA1/2 mutation carriers.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19549356 2009 [Relationship between NQO1C(609T), RAD51(G135C), XRCC3(C241T) single nucleotide polymorphisms and acute lymphoblastic leukemia].
19540122 2009 The carboxyl terminus of Brca2 links the disassembly of Rad51 complexes to mitotic entry.
19536092 2009 Explorative study to identify novel candidate genes related to oxaliplatin efficacy and toxicity using a DNA repair array.
19505457 2009 Emodin enhances gefitinib-induced cytotoxicity via Rad51 downregulation and ERK1/2 inactivation.
19427856 2009 Detection of c-Abl kinase-promoted phosphorylation of Rad51 by specific antibodies reveals that Y54 phosphorylation is dependent on that of Y315.
19426727 2009 Polymorphism of the homologous recombination repair genes RAD51 and XRCC3 in breast cancer.
19386720 2009 Homologous recombinational repair factors are recruited and loaded onto the viral DNA genome in Epstein-Barr virus replication compartments.
19338310 2009 Streamline proteomic approach for characterizing protein-protein interaction network in a RAD52 protein complex.
19329439 2009 Recombination activator function of the novel RAD51- and RAD51B-binding protein, human EVL.
19303847 2009 The BRC repeats of BRCA2 modulate the DNA-binding selectivity of RAD51.
19285032 2009 c-ABL tyrosine kinase stabilizes RAD51 chromatin association.
19253839 2008 [Association of polymorphisms of N372H in BRCA2 gene and 135G/C in RAD51 gene and breast cancers].
19251090 2009 Acute normal tissue reactions in head-and-neck cancer patients treated with IMRT: influence of dose and association with genetic polymorphisms in DNA DSB repair genes.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
19214744 2010 CASP8 D302H polymorphism delays the age of onset of breast cancer in BRCA1 and BRCA2 carriers.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19165339 2009 Interplay of Mre11 nuclease with Dna2 plus Sgs1 in Rad51-dependent recombinational repair.
19157634 2009 The role of celecoxib in Rad51 expression and cell survival affected by gefitinib in human non-small cell lung cancer cells.
19150983 2009 FANCJ uses its motor ATPase to destabilize protein-DNA complexes, unwind triplexes, and inhibit RAD51 strand exchange.
19140342 2008 [Human RAD51 recombinase: the role in the cell cycle checkpoint and cellular survival].
19133161 2009 Human Rad51 mediated DNA unwinding is facilitated by conditions that favour Rad51-dsDNA aggregation.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19122145 2009 Direct imaging of human Rad51 nucleoprotein dynamics on individual DNA molecules.
19117011 2009 Estrogen receptor beta-mediated nuclear interaction between IRS-1 and Rad51 inhibits homologous recombination directed DNA repair in medulloblastoma.
19116388 2009 A field synopsis on low-penetrance variants in DNA repair genes and cancer susceptibility.
19097142 2009 Nuclear matrix binding site in the Rad51 recombinase.
19092295 2008 RAD52 polymorphisms contribute to the development of papillary thyroid cancer susceptibility in Middle Eastern population.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19071013 2009 Do BRCA1 modifiers also affect the risk of breast cancer in non-carriers?
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19064565 2008 Common single-nucleotide polymorphisms in DNA double-strand break repair genes and breast cancer risk.
19060884 2009 Counting RAD51 proteins disassembling from nucleoprotein filaments under tension.
19027952 2009 Polymorphisms of detoxification and DNA repair enzymes in myelodyplastic syndromes.
19010915 2008 AKT1 inhibits homologous recombination by inducing cytoplasmic retention of BRCA1 and RAD51.
19004837 2009 Reversibility, equilibration, and fidelity of strand exchange reaction between short oligonucleotides promoted by RecA protein from escherichia coli and human Rad51 and Dmc1 proteins.
18990028 Genotype-phenotype relationship between DNA repair gene genetic polymorphisms and DNA repair capacity.
18978339 2009 Large-scale evaluation of candidate genes identifies associations between DNA repair and genomic maintenance and development of benzene hematotoxicity.
18977234 2008 Association between DNA damage, DNA repair genes variability and clinical characteristics in breast cancer patients.
18974064 2009 Genetic variants of BLM interact with RAD51 to increase breast cancer susceptibility.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18840682 2008 A chemical compound that stimulates the human homologous recombination protein RAD51.
18834951 2009 RAD51 foci formation in response to DNA damage is modulated by TIP49.
18794841 2008 Cell-cycle coordination between DNA replication and recombination revealed by a vertebrate N-end rule degron-Rad51.
18768166 2008 Single-nucleotide polymorphisms in DNA double-strand break repair genes: association with head and neck cancer and interaction with tobacco use and alcohol consumption.
18761348 2008 Structural analysis of the human Rad51 protein-DNA complex filament by tryptophan fluorescence scanning analysis: transmission of allosteric effects between ATP binding and DNA binding.
18756535 2008 RAD51 and XRCC3 polymorphism frequency and risk of myelodysplastic syndromes.
18752184 2008 The investigation of DNA repair polymorphisms with histopathological characteristics and hormone receptors in a group of Brazilian women with breast cancer.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18632222 2008 Loss of heterozygosity in the RAD51 and BRCA2 regions in breast cancer.
18618591 2009 Rad51 overexpression rescues radiation resistance in BRCA2-defective cancer cells.
18617519 2008 Rad51 protein stimulates the branch migration activity of Rad54 protein.
18581889 2008 [Polymorphisms of RAD51(G135C) and XRCC3(C241T) genes and correlations thereof with prognosis and clinical outcomes of acute myeloid leukemia].
18570881 2008 A Rad51 presynaptic filament is sufficient to capture nucleosomal homology during recombinational repair of a DNA double-strand break.
18544565 2008 Involvement of Rad51 in cytotoxicity induced by epidermal growth factor receptor inhibitor (gefitinib, IressaR) and chemotherapeutic agents in human lung cancer cells.
18535008 2008 A comparative analysis of Dmc1 and Rad51 nucleoprotein filaments.
18449195 2008 Single-stranded DNA-binding protein hSSB1 is critical for genomic stability.
18439040 2008 Radiation enhances caspase 3 cleavage of Rad51 in BRCA2-defective cells.
18429825 2008 Dinucleotide repeat polymorphisms of RAD51, BRCA1, BRCA2 gene regions in breast cancer.
18417535 2008 Identification of a novel human Rad51 variant that promotes DNA strand exchange.
18413737 2008 Distinct RAD51 associations with RAD52 and BCCIP in response to DNA damage and replication stress.
18317453 2008 The checkpoint kinases Chk1 and Chk2 regulate the functional associations between hBRCA2 and Rad51 in response to DNA damage.
18256600 2008 Formation and branch migration of Holliday junctions mediated by eukaryotic recombinases.
18203022 2008 Germline mutations in RAD51, RAD51AP1, RAD51B, RAD51C,RAD51D, RAD52 and RAD54L do not contribute to familial chronic lymphocytic leukemia.
18173750 2008 The Lys313 residue of the human Rad51 protein negatively regulates the strand-exchange activity.
18033323 2008 DNA repair polymorphisms and outcome of chemotherapy for acute myelogenous leukemia: a report from the Children's Oncology Group.
17999359 2007 RAD51 135G-->C modifies breast cancer risk among BRCA2 mutation carriers: results from a combined analysis of 19 studies.
17947332 2007 Real-time measurements of the nucleation, growth and dissociation of single Rad51-DNA nucleoprotein filaments.
17942895 2007 RAD51 up-regulation bypasses BRCA1 function and is a common feature of BRCA1-deficient breast tumors.
17889711 2007 RAD51 135G>C polymorphism and risk of familial breast cancer in a South American population.
17802824 2007 [Expression of RAD51 in carcinomas of cancer of larynx and its clinical significance].
17761709 2007 Increased risk of acute myeloid leukaemia due to polymorphisms in detoxification and DNA repair enzymes.
17709342 2007 Real-time assembly and disassembly of human RAD51 filaments on individual DNA molecules.
17685459 2007 Polymorphism in nucleotide excision repair gene XPC correlates with bleomycin-induced chromosomal aberrations.
17672918 2007 Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.
17666788 2007 Altered DNA binding by the human Rad51-R150Q mutant found in breast cancer patients.
17639080 2007 Bipartite stimulatory action of the Hop2-Mnd1 complex on the Rad51 recombinase.
17616806 2008 XRCC1 Arg399Gln and RAD51 5'UTR G135C polymorphisms and their outcome in tumor aggressiveness and survival of Portuguese breast cancer patients.
17591918 2007 BLM helicase-dependent and -independent roles of 53BP1 during replication stress-mediated homologous recombination.
17557904 2007 Evaluation of genetic variation in the double-strand break repair pathway and bladder cancer risk.
17549502 2007 Structure of human BRCA2-RAD51 by molecular docking study.
17544928 2007 Synergistic action of the Saccharomyces cerevisiae homologous recombination factors Rad54 and Rad51 in chromatin remodeling.
17541404 2007 Interactions between human BRCA2 protein and the meiosis-specific recombinase DMC1.
17515904 2007 Stabilization of RAD51 nucleoprotein filaments by the C-terminal region of BRCA2.
17515903 2007 Interaction with the BRCA2 C terminus protects RAD51-DNA filaments from disassembly by BRC repeats.
17513613 2007 Rad51 overexpression contributes to chemoresistance in human soft tissue sarcoma cells: a role for p53/activator protein 2 transcriptional regulation.
17483448 2007 Stabilization of RAD-51-DNA filaments via an interaction domain in Caenorhabditis elegans BRCA2.
17483304 2007 Biallelic mutation of MSH2 in primary human cells is associated with sensitivity to irradiation and altered RAD51 foci kinetics.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17302439 2007 The human Rad51 K133A mutant is functional for DNA double-strand break repair in human cells.
17301259 2007 The RAD51 135 G>C polymorphism modifies breast cancer and ovarian cancer risk in Polish BRCA1 mutation carriers.
17180310 2007 Genetic instability in the RAD51 and BRCA1 regions in breast cancer.
17118968 2007 172G>T variant in the 5' untranslated region of DNA repair gene RAD51 reduces risk of squamous cell carcinoma of the head and neck and interacts with a P53 codon 72 variant.
17078101 2006 Influence of polymorphisms in xenobiotic-metabolizing genes and DNA-repair genes on diepoxybutane-induced SCE frequency.
17063276 2007 DNA repair polymorphisms might contribute differentially on familial and sporadic breast cancer susceptibility: a study on a Portuguese population.
17007294 2006 [The G/C polymorphism of RAD51 gene in breast cancer].
17001309 2007 Repression of RAD51 gene expression by E2F4/p130 complexes in hypoxia.
16990250 2006 RAD51AP2, a novel vertebrate- and meiotic-specific protein, shares a conserved RAD51-interacting C-terminal domain with RAD51AP1/PIR51.
16979659 2006 Visualizing the assembly of human Rad51 filaments on double-stranded DNA.
16902145 2006 Polymorphisms in human homeobox HLX1 and DNA repair RAD51 genes increase the risk of therapy-related acute myeloid leukemia.
16890287 2007 RAD51 homologous recombination repair gene haplotypes and risk of acute myeloid leukaemia.
16843501 2006 DNA damage and repair in gastric cancer--a correlation with the hOGG1 and RAD51 genes polymorphisms.
16837909 2006 Analysis of RAD51 polymorphism and BRCA1 mutations in Polish women with breast cancer.
16756962 2006 XPA versus ERCC1 as chemosensitising agents to cisplatin and mitomycin C in prostate cancer cells: role of ERCC1 in homologous recombination repair.
16723430 2006 Human Rad51 protein displays enhanced homologous pairing of DNA sequences resembling those at genetically unstable loci.
16644292 2006 Defining the salt effect on human RAD51 activities.
16638864 2006 Association of DNA repair and steroid metabolism gene polymorphisms with clinical late toxicity in patients treated with conformal radiotherapy for prostate cancer.
16629903 2006 Sub-nuclear localization of Rad51 in response to DNA damage.
16624636 2006 Magnesium influences the discrimination and release of ADP by human RAD51.
16624550 2006 A specific RAD51 haplotype increases breast cancer risk in Jewish non-Ashkenazi high-risk women.
16596227 2006 Pilot study examining tumor expression of RAD51 and clinical outcomes in human head cancers.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16516153 2006 p53 is involved in clearance of ionizing radiation-induced RAD51 foci in a human colon cancer cell line.
16477874 2005 Germline BRCA1 mutations and G/C polymorphism in the 5'-untranslated region of the RAD51 gene in Polish women with breast cancer.
16475125 2005 DNA repair gene polymorphisms and susceptibility to familial breast cancer in a group of patients from Campinas, Brazil.
16432240 2006 Long-distance lateral diffusion of human Rad51 on double-stranded DNA.
16428451 2006 Differential contributions of mammalian Rad54 paralogs to recombination, DNA damage repair, and meiosis.
16427610 2006 Rad51-related changes in global gene expression.
16398215 2005 Characterisation of the promoter region of the human DNA-repair gene Rad51.
16395335 2006 Interplay between human DNA repair proteins at a unique double-strand break in vivo.
16367760 2006 DNA mediated disassembly of hRad51 and hRad52 proteins and recruitment of hRad51 to ssDNA by hRad52.
16261408 2005 Polymorphisms of the BRCA2 and RAD51 genes in breast cancer.
16215984 2005 Cellular localization of human Rad51C and regulation of ubiquitin-mediated proteolysis of Rad51.
16186822 2005 MDC1 interacts with Rad51 and facilitates homologous recombination.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16018971 2005 Effect of DNA sequence and nucleotide cofactors on hRad51 binding to ssDNA: role of hRad52 in recruitment.
16000324 2005 Up-regulation of the ubiquitous alternative splicing factor Tra2beta causes inclusion of a germ cell-specific exon.
15965906 2006 T-antigen of the human polyomavirus JC attenuates faithful DNA repair by forcing nuclear interaction between IRS-1 and Rad51.
15958648 2005 Genetic polymorphisms of selected DNA repair genes, estrogen and progesterone receptor status, and breast cancer risk.
15944450 2005 Human Rad51 filaments on double- and single-stranded DNA: correlating regular and irregular forms with recombination function.
15899844 2005 Fission yeast rad51 and dmc1, two efficient DNA recombinases forming helical nucleoprotein filaments.
15800615 2005 CDK-dependent phosphorylation of BRCA2 as a regulatory mechanism for recombinational repair.
15766559 2005 Interaction of hRad51 and hRad52 with MCM complex: a cross-talk between recombination and replication proteins.
15750625 2005 BLM helicase is activated in BCR/ABL leukemia cells to modulate responses to cisplatin.
15734952 2005 Double-strand break repair gene polymorphisms and risk of breast or ovarian cancer.
15713648 2005 The BRCA2-interacting protein BCCIP functions in RAD51 and BRCA2 focus formation and homologous recombinational repair.
15671039 2005 Fanconi anemia complementation group D2 (FANCD2) functions independently of BRCA2- and RAD51-associated homologous recombination in response to DNA damage.
15665856 2005 The cell-cycle checkpoint kinase Chk1 is required for mammalian homologous recombination repair.
15611070 2005 Binding of Rad51 and other peptide sequences to a promiscuous, highly electrostatic binding site in p53.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466868 2004 Human Rad54 protein stimulates DNA strand exchange activity of hRad51 protein in the presence of Ca2+.
15330855 2004 Mutational analyses of the human Rad51-Tyr315 residue, a site for phosphorylation in leukaemia cells.
15313891 2004 Polymorphisms of DNA repair genes and risk of glioma.
15226506 2004 Ca2+ activates human homologous recombination protein Rad51 by modulating its ATPase activity.
15165851 2004 Location of tyrosine 315, a target for phosphorylation by cAbl tyrosine kinase, at the edge of the subunit-subunit interface of the human Rad51 filament.
15138485 2004 A single-nucleotide polymorphism in the RAD51 gene modifies breast cancer risk in BRCA2 carriers, but not in BRCA1 carriers or noncarriers.
15123651 2004 hXRCC2 enhances ADP/ATP processing and strand exchange by hRAD51.
15102670 2004 Polymorphisms in genes involved in homologous recombination repair interact to increase the risk of developing acute myeloid leukemia.
15095978 2004 P53 inhibits strand exchange and replication fork regression promoted by human Rad51.
15064730 2004 The mismatch DNA repair heterodimer, hMSH2/6, regulates BLM helicase.
15036125 2004 Influence of GSTT1, mEH, CYP2E1 and RAD51 polymorphisms on diepoxybutane-induced SCE frequency in cultured human lymphocytes.
14724582 2004 Rad51 overexpression promotes alternative double-strand break repair pathways and genome instability.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14599770 2003 Homologous recombination and cell cycle checkpoints: Rad51 in tumour progression and therapy resistance.
14580352 2003 Dynamic control of Rad51 recombinase by self-association and interaction with BRCA2.
14559999 2003 Role of the insulin-like growth factor I/insulin receptor substrate 1 axis in Rad51 trafficking and DNA repair by homologous recombination.
12917330 2003 Nuclease-deficient FEN-1 blocks Rad51/BRCA1-mediated repair and causes trinucleotide repeat instability.
12883740 Rad52 gene mutations in breast/ovarian cancer families and sporadic ovarian carcinoma patients.
12826751 2002 Effects of higher-order nuclear structure and Rad51 overexpression on radiation-induced chromosome rearrangements.
12750383 2003 WRN interacts physically and functionally with the recombination mediator protein RAD52.
12750285 2003 p53 interacts with hRAD51 and hRAD54, and directly modulates homologous recombination.
12750242 2003 Breast cancer risk reduction associated with the RAD51 polymorphism among carriers of the BRCA1 5382insC mutation in Poland.
12673366 2003 Analysis of the G/C polymorphism in the 5'-untranslated region of the RAD51 gene in breast cancer.
12650908 2003 Ionizing radiation-induced Rad51 nuclear focus formation is cell cycle-regulated and defective in both ATM(-/-) and c-Abl(-/-) cells.
12619154 2003 Deletion of Brca2 exon 27 causes hypersensitivity to DNA crosslinks, chromosomal instability, and reduced life span in mice.
12606939 2003 BRCA2-dependent and independent formation of RAD51 nuclear foci.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12442171 2002 Insights into DNA recombination from the structure of a RAD51-BRCA2 complex.
12427746 2003 Complex formation by the human Rad51B and Rad51C DNA repair proteins and their activities in vitro.
12379650 2002 Regulation of ionizing radiation-induced Rad52 nuclear foci formation by c-Abl-mediated phosphorylation.
12359753 2002 Regulation of cisplatin resistance and homologous recombinational repair by the TFIIH subunit XPD.
12242698 2002 Highlight: BRCA1 and BRCA2 proteins in breast cancer.
12242278 2002 Homologous recombination resolution defect in werner syndrome.
12239151 2002 S-phase-specific interaction of the Fanconi anemia protein, FANCD2, with BRCA1 and RAD51.
12226092 2002 Correlation of biochemical properties with the oligomeric state of human rad52 protein.
12205100 2002 Homologous DNA pairing by human recombination factors Rad51 and Rad54.
12077133 2002 Rad52 protein associates with replication protein A (RPA)-single-stranded DNA to accelerate Rad51-mediated displacement of RPA and presynaptic complex formation.
12036913 2002 Effect of germ-line genetic variation on breast cancer survival in a population-based study.
12023982 2002 Variants in DNA double-strand break repair genes and breast cancer susceptibility.
11867550 2002 Functional proteomics of transforming growth factor-beta1-stimulated Mv1Lu epithelial cells: Rad51 as a target of TGFbeta1-dependent regulation of DNA repair.
11842113 2002 Involvement of Rad51C in two distinct protein complexes of Rad51 paralogs in human cells.
11809887 2002 Differential effects of Rad52p overexpression on gene targeting and extrachromosomal homologous recombination in a human cell line.
11691922 2001 Overexpression of human RAD51 and RAD52 reduces double-strand break-induced homologous recombination in mammalian cells.
11684015 2001 BCR/ABL regulates mammalian RecA homologs, resulting in drug resistance.
11535547 2001 A single nucleotide polymorphism in the 5' untranslated region of RAD51 and risk of cancer among BRCA1/2 mutation carriers.
11477095 2001 Analysis of murine Brca2 reveals conservation of protein-protein interactions but differences in nuclear localization signals.
11337467 2001 Identification and characterization of the potential promoter regions of 1031 kinds of human genes.
11309417 2001 Regulation and localization of the Bloom syndrome protein in response to DNA damage.
11278509 2001 Potential role for the BLM helicase in recombinational repair via a conserved interaction with RAD51.
11256631 2000 Coordinated response of mammalian Rad51 and Rad52 to DNA damage.
11248061 2001 A single nucleotide polymorphism in the RAD51 gene modifies cancer risk in BRCA2 but not BRCA1 carriers.
11239456 2001 Role of BRCA2 in control of the RAD51 recombination and DNA repair protein.
11154282 2001 Molecular dissection of interactions between Rad51 and members of the recombination-repair group.
11080452 2000 Reconstitution of the strand invasion step of double-strand break repair using human Rad51 Rad52 and RPA proteins.
11005857 2000 Tid1/Rdh54 promotes colocalization of rad51 and dmc1 during meiotic recombination.
11002423 2000 Role of heteroduplex joints in the functional interactions between human Rad51 and wild-type p53.
10998058 2000 Caspase-3 mediated cleavage of HsRad51 at an unconventional site.
10851248 2000 A novel human rad54 homologue, Rad54B, associates with Rad51.
10851081 2000 DNA repair and recombination factor Rad51 is over-expressed in human pancreatic adenocarcinoma.
10807537 2000 Identification of Rad51 alteration in patients with bilateral breast cancer.
10619018 1999 Rapid exchange of A:T base pairs is essential for recognition of DNA homology by human Rad51 recombination protein.
10562567 1999 The meiosis-specific recombinase hDmc1 forms ring structures and interacts with hRad51.
10551859 1999 Expression of BRC repeats in breast cancer cells disrupts the BRCA2-Rad51 complex and leads to radiation hypersensitivity and loss of G(2)/M checkpoint control.
10493508 1999 Characterization of the human Rad51 genomic locus and examination of tumors with 15q14-15 loss of heterozygosity (LOH).
10446958 1999 BRCA2 is required for ionizing radiation-induced assembly of Rad51 complex in vivo.
10438626 1999 Heteroduplex formation by human Rad51 protein: effects of DNA end-structure, hRP-A and hRad52.
10390347 1999 The N-terminal domain of the human Rad51 protein binds DNA: structure and a DNA binding surface as revealed by NMR.
10212258 1999 Radiation-induced assembly of Rad51 and Rad52 recombination complex requires ATM and c-Abl.
10082566 1999 Role for caspase-mediated cleavage of Rad51 in induction of apoptosis by DNA damage.
9891849 1998 Characterization of mouse ubiquitin-like SMT3A and SMT3B cDNAs and gene/pseudogenes.
9880493 1999 Human Rad51 protein can form homologous joints in the absence of net strand exchange.
9826763 1998 Interaction of human rad51 recombination protein with single-stranded DNA binding protein, RPA.
9774970 1998 Stable interaction between the products of the BRCA1 and BRCA2 tumor suppressor genes in mitotic and meiotic cells.
9660962 1998 XRCC2 and XRCC3, new human Rad51-family members, promote chromosome stability and protect against DNA cross-links and other damages.
9607320 1998 Proteolytic cleavage of HsRad51 during apoptosis.
9560268 1998 The BRC repeats in BRCA2 are critical for RAD51 binding and resistance to methyl methanesulfonate treatment.
9469824 1998 Isolation and characterization of RAD51C, a new human member of the RAD51 family of related genes.
9461559 1998 Regulation of Rad51 function by c-Abl in response to DNA damage.
9396801 1997 A novel nucleic acid-binding protein that interacts with human rad51 recombinase.
9380510 1997 Interaction of p53 with the human Rad51 protein.
9321665 1997 Interaction of human recombination proteins Rad51 and Rad54.
9192668 1997 RAB22 and RAB163/mouse BRCA2: proteins that specifically interact with the RAD51 protein.
9126738 1997 Embryonic lethality and radiation hypersensitivity mediated by Rad51 in mice lacking Brca2.
9121429 1997 The human immunodeficiency virus transactivator Tat interacts with the RNA polymerase II holoenzyme.
9008167 1997 Association of BRCA1 with Rad51 in mitotic and meiotic cells.
8929543 1996 Human Rad51 protein promotes ATP-dependent homologous pairing and strand transfer reactions in vitro.
8921390 1996 Associations of UBE2I with RAD52, UBL1, p53, and RAD51 proteins in a yeast two-hybrid system.
8816780 1996 Rad51 expression and localization in B cells carrying out class switch recombination.
8812453 1996 UBL1, a human ubiquitin-like protein associating with human RAD51/RAD52 proteins.
8703992 1996 Expression of the human RAD51 gene during the cell cycle in primary human peripheral blood lymphocytes.
8675009 1996 The XPB and XPD DNA helicases are components of the p53-mediated apoptosis pathway.
8617246 1996 p53 is linked directly to homologous recombination processes via RAD51/RecA protein interaction.
8610150 1996 Mammalian ubiquitin-conjugating enzyme Ubc9 interacts with Rad51 recombination protein and localizes in synaptonemal complexes.
8479919 1993 Cloning and sequence of the human RecA-like gene cDNA.
8358431 1993 Cloning of human, mouse and fission yeast recombination genes homologous to RAD51 and recA.
8188269 1994 Chromosome mapping of the human (RECA) and mouse (Reca) homologs of the yeast RAD51 and Escherichia coli recA genes to human (15q15.1) and mouse (2F1) chromosomes by direct R-banding fluorescence in situ hybridization.
7988572 1994 Purification and characterization of the human Rad51 protein, an analogue of E. coli RecA.