Property Summary

NCBI Gene PubMed Count 27
PubMed Score 6.31
PubTator Score 13.71

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (8)

PMID Text
25046748 POU5F1P1 rs10505477 is correlated with survival of gastric cancer patients who receving cisplatin-based chemotherapy after gastrectomy.
24362523 The POU5F1B pseudogene is amplified and expressed at a high level in, as well as confers an aggressive phenotype on, GC, and that POU5F1B amplification is associated with a poor prognosis in GC patients.
24338422 Association of rs7014346 in POU5F1P1, rs989902 in PTPN13, and rs7003146 in TCF7L2 with variations in the risk of breast cancer in a Chinese Han population.
23064289 Data suggest that expression of Oct4 and NANOG (Nanog homeobox protein) is up-regulated in visceral adipose tissue stem cells in type 2 diabetes as compared to control; expression is also up-regulated in hyperglycemic conditions.
20158306 Observational study of gene-disease association. (HuGE Navigator)
20017164 Over-expression of POU5F1P1 in prostatic carcinoma in addition to its genomic location and the putative function of its gene product render POU5F1P1 a good candidate to harbour functional genetic variants which modulate prostatic cancer susceptibility.
19562729 Observational study of gene-disease association. (HuGE Navigator)
18949397 that a putative POU5F1P1 protein is localized in the nucleus, acts as a transcriptional activator and regulates the expression in a similar way to the POU5F1 isoform 1

AA Sequence

MAGHLASDFAFSPPPGGGGDGPWGAEPGWVDPLTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYELC      1 - 70
GGMAYCGPQVGVGLVPQGGLETSQPESEAGVGVESNSNGASPEPCTVPPGAVKLEKEKLEQNPEKSQDIK     71 - 140
ALQKELEQFAKLLKQKRITLGYTQADVGLILGVLFGKVFSQKTICRFEALQLSFKNMCKLRPLLQKWVEE    141 - 210
ADNNENLQEICKAETLMQARKRKRTSIENRVRGNLENLFLQCPKPTLQISHIAQQLGLEKDVVRVWFCNR    211 - 280
RQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPPAPGPHFGTPGYGSPHFTALYSSVPFPEGEVFPPVSVI    281 - 350
TLGSPMHSN                                                                 351 - 359
//

Text Mined References (29)

PMID Year Title
25046748 2014 Clinical significance of POU5F1P1 rs10505477 polymorphism in Chinese gastric cancer patients receving cisplatin-based chemotherapy after surgical resection.
24861552 2014 Genome-wide association study yields variants at 20p12.2 that associate with urinary bladder cancer.
24753544 2014 Genetic variation in prostate-specific antigen-detected prostate cancer and the effect of control selection on genetic association studies.
24586860 2014 Expression and differentiation between OCT4A and its Pseudogenes in human ESCs and differentiated adult somatic cells.
24362523 2015 The OCT4 pseudogene POU5F1B is amplified and promotes an aggressive phenotype in gastric cancer.
24338422 2013 Colorectal cancer susceptibility variants alter risk of breast cancer in a Chinese Han population.
24292274 2014 A genome-wide association study identifies multiple susceptibility loci for chronic lymphocytic leukemia.
23933063 2013 Differential expression of Oct4 variants and pseudogenes in normal urothelium and urothelial cancer.
23064289 2013 A diabetic milieu promotes OCT4 and NANOG production in human visceral-derived adipose stem cells.
22041458 2012 Pharmacogenomic study of side-effects for antidepressant treatment options in STAR*D.
More...