Property Summary

NCBI Gene PubMed Count 38
Grant Count 1
Funding $70,000
PubMed Score 14.00
PubTator Score 15.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
non-small cell lung cancer -1.124 0.000

Synonym

Accession Q06033 Q3B7H5 Q53F06 Q6LAM2 Q99085 ITI heavy chain H3
Symbols H3P
SHAP
ITI-HC3

Gene

 Grant Application (1)

Gene RIF (9)

PMID Text
26206863 confirmed the association of schizophrenia with ITIH3/4 in a Han Chinese population
24461634 A novel association between suicide attempt and the ITIH3/4-region in a combined group of patients with bipolar disorder, schizophrenia and related psychosis spectrum disorders.
24373612 Study showed the association of a polymorphism (rs2535629) of ITIH3 with psychiatric disorders in an Asian population and that rs2535629 influences the susceptibility to psychiatric disorders by affecting the expression level of GLT8D1
22614287 This study demonistrated that Genome-wide significant associations in schizophrenia to ITIH3/4 and extensive replication of associations reported by the Schizophrenia.
20515073 ITIH3 protein was found to be more highly expressed in plasma of tumor bearing mice compared to control.
17898697 Widespread heavy chain 3 was only present in urinary stone formers
17211523 Observational study of gene-disease association. (HuGE Navigator)
17211523 ITIH3 single-nucleotide polymorphism is a novel genetic risk factor of myocardial infarction.
11807786 Transfection into H460M Human large cell lung carcinoma line decreased tumor metastasis in nude mice

AA Sequence

MAFAWWPCLILALLSSLAASGFPRSPFRLLGKRSLPEGVANGIEVYSTKINSKVTSRFAHNVVTMRAVNR      1 - 70
ADTAKEVSFDVELPKTAFITNFTLTIDGVTYPGNVKEKEVAKKQYEKAVSQGKTAGLVKASGRKLEKFTV     71 - 140
SVNVAAGSKVTFELTYEELLKRHKGKYEMYLKVQPKQLVKHFEIEVDIFEPQGISMLDAEASFITNDLLG    141 - 210
SALTKSFSGKKGHVSFKPSLDQQRSCPTCTDSLLNGDFTITYDVNRESPGNVQIVNGYFVHFFAPQGLPV    211 - 280
VPKNVAFVIDISGSMAGRKLEQTKEALLRILEDMQEEDYLNFILFSGDVSTWKEHLVQATPENLQEARTF    281 - 350
VKSMEDKGMTNINDGLLRGISMLNKAREEHRIPERSTSIVIMLTDGDANVGESRPEKIQENVRNAIGGKF    351 - 420
PLYNLGFGNNLNYNFLENMALENHGFARRIYEDSDADLQLQGFYEEVANPLLTGVEMEYPENAILDLTQN    421 - 490
TYQHFYDGSEIVVAGRLVDEDMNSFKADVKGHGATNDLTFTEEVDMKEMEKALQERDYIFGNYIERLWAY    491 - 560
LTIEQLLEKRKNAHGEEKENLTARALDLSLKYHFVTPLTSMVVTKPEDNEDERAIADKPGEDAEATPVSP    561 - 630
AMSYLTSYQPPQNPYYYVDGDPHFIIQIPEKDDALCFNIDEAPGTVLRLIQDAVTGLTVNGQITGDKRGS    631 - 700
PDSKTRKTYFGKLGIANAQMDFQVEVTTEKITLWNRAVPSTFSWLDTVTVTQDGLSMMINRKNMVVSFGD    701 - 770
GVTFVVVLHQVWKKHPVHRDFLGFYVVDSHRMSAQTHGLLGQFFQPFDFKVSDIRPGSDPTKPDATLVVK    771 - 840
NHQLIVTRGSQKDYRKDASIGTKVVCWFVHNNGEGLIDGVHTDYIVPNLF                        841 - 890
//

Text Mined References (40)

PMID Year Title
26206863 2015 Loci with genome-wide associations with schizophrenia in the Han Chinese population.
25414627 2014 Neuroinformatic analyses of common and distinct genetic components associated with major neuropsychiatric disorders.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24461634 2014 Association analysis between suicidal behaviour and candidate genes of bipolar disorder and schizophrenia.
24373612 2014 ITIH3 polymorphism may confer susceptibility to psychiatric disorders by altering the expression levels of GLT8D1.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
22614287 2013 Genome-wide significant associations in schizophrenia to ITIH3/4, CACNA1C and SDCCAG8, and extensive replication of associations reported by the Schizophrenia PGC.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
More...