Property Summary

NCBI Gene PubMed Count 24
Grant Count 43
R01 Count 23
Funding $5,119,998.59
PubMed Score 204.16
PubTator Score 64.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
subependymal giant cell astrocytoma -2.198 0.033

Gene RIF (6)

PMID Text
24934154 ZP2(51-149) sperm-binding domain is necessary for human gamete recognition and penetration through the zona pellucida.
23417405 Studies indicate that eggs from mice lacking an ortholog of ZP2 do not contain a zona pellucida (ZP), and the mice are completely infertile due to a severely reduced number of ovulated eggs in their oviducts.
22889493 observed sequence variations in exons of ZP2 gene in women with infertility of unknown origin who exhibit abnormal zona pellucida; sperm-ovum interactions appear relatively normal in these patients [CASE REPORTS]
18033806 ZP proteins were detected in both the oocyte and the granulosa cells as early as the primordial follicle stage in the human. The detection of ZP proteins in the quiescent primordial follicle suggests that these proteins have been present since oogenesis.
16407501 Exposure of sperm to ZP proteins promoted acrosomal exocytosis and changed motility patterns.
15950651 Of all zona pellucida (ZP) proteins, recombinant human ZPA demonstrates the highest binding activity toward acrosin

AA Sequence

MACRQRGGSWSPSGWFNAGWSTYRSISLFFALVTSGNSIDVSQLVNPAFPGTVTCDEREITVEFPSSPGT      1 - 70
KKWHASVVDPLGLDMPNCTYILDPEKLTLRATYDNCTRRVHGGHQMTIRVMNNSAALRHGAVMYQFFCPA     71 - 140
MQVEETQGLSASTICQKDFMSFSLPRVFSGLADDSKGTKVQMGWSIEVGDGARAKTLTLPEAMKEGFSLL    141 - 210
IDNHRMTFHVPFNATGVTHYVQGNSHLYMVSLKLTFISPGQKVIFSSQAICAPDPVTCNATHMTLTIPEF    211 - 280
PGKLKSVSFENQNIDVSQLHDNGIDLEATNGMKLHFSKTLLKTKLSEKCLLHQFYLASLKLTFLLRPETV    281 - 350
SMVIYPECLCESPVSIVTGELCTQDGFMDVEVYSYQTQPALDLGTLRVGNSSCQPVFEAQSQGLVRFHIP    351 - 420
LNGCGTRYKFEDDKVVYENEIHALWTDFPPSKISRDSEFRMTVKCSYSRNDMLLNINVESLTPPVASVKL    421 - 490
GPFTLILQSYPDNSYQQPYGENEYPLVRFLRQPIYMEVRVLNRDDPNIKLVLDDCWATSTMDPDSFPQWN    491 - 560
VVVDGCAYDLDNYQTTFHPVGSSVTHPDHYQRFDMKAFAFVSEAHVLSSLVYFHCSALICNRLSPDSPLC    561 - 630
SVTCPVSSRHRRATGATEAEKMTVSLPGPILLLSDDSSFRGVGSSDLKASGSSGEKSRSETGEEVGSRGA    631 - 700
MDTKGHKTAGDVGSKAVAAVAAFAGVVATLGFIYYLYEKRTVSNH                             701 - 745
//

Text Mined References (26)

PMID Year Title
24934154 2014 A single domain of the ZP2 zona pellucida protein mediates gamete recognition in mice and humans.
23417405 2012 Influence of the zona pellucida of the mouse egg on folliculogenesis and fertility.
22889493 2012 Genetic and physiological study of morphologically abnormal human zona pellucida.
22472438 2012 Ovastacin, a cortical granule protease, cleaves ZP2 in the zona pellucida to prevent polyspermy.
20394732 2010 Recombinant human ZP3-induced sperm acrosome reaction: evidence for the involvement of T- and L-type voltage-gated calcium channels.
18033806 2008 Detection of zona pellucida proteins during human folliculogenesis.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16407501 2006 Biological effects of recombinant human zona pellucida proteins on sperm function.
15950651 2005 Binding of recombinant human proacrosin/acrosin to zona pellucida (ZP) glycoproteins. I. Studies with recombinant human ZPA, ZPB, and ZPC.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
More...