Property Summary

NCBI Gene PubMed Count 26
PubMed Score 16.48
PubTator Score 207.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Juvenile arthritis 124
Disease Target Count P-value
inflammatory breast cancer 404 1.70416995575063E-10
posterior fossa group B ependymoma 1530 1.58735941417167E-6
psoriasis 6685 4.59042203680472E-5
ovarian cancer 8492 9.02388091941876E-5
interstitial cystitis 2299 9.23753504128711E-5
primitive neuroectodermal tumor 3031 1.10497087137943E-4
cystic fibrosis 1670 1.13829669074344E-4
atypical teratoid/rhabdoid tumor 1095 1.89978705639235E-4
pituitary cancer 1972 5.37543631021975E-4
pediatric high grade glioma 2712 7.41222182945917E-4
ulcerative colitis 2087 0.00192459211710559
oligodendroglioma 2849 0.00235551147947425
chronic lymphocytic leukemia 244 0.0167907879743285
Waldenstrons macroglobulinemia 765 0.0257611615080749
hepatocellular carcinoma 550 0.0296391050091754
urothelial carcinoma 318 0.0499961404152724

Expression

  Differential Expression (16)

Synonym

Accession Q05923 Q53T45
Symbols PAC1
PAC-1

Gene

PDB

1M3G  

  Ortholog (7)

Gene RIF (16)

PMID Text
26833217 Our data show that aberrant epigenetic inactivation of DUSP2 occurs in carcinogenesis and that CTCF is involved in the epigenetic regulation of DUSP2 expression.
26658840 Highly recurrent mutation of DUSP2 is associated with nodular lymphocyte predominant Hodgkin lymphoma.
26207425 identified among the key genes in circulating monocytes that were altered by exercise
25596742 Data show that hypoxia promotes lapatinib resistance in ERBB2-positive breast cancer cells through activation of the MEK-ERK pathway a HIF-1-dependent manner via regulation of dual-specificity phosphatase 2 (DUSP2).
21984126 DUSP2 is an important molecule in endometrial physiology and that hypoxia-inhibited DUSP2 expression is a critical factor for the development of endometriosis.
21490398 DUSP2 is a key downstream regulator of HIF-1-mediated tumor progression and chemoresistance
20723301 Dipyridamole reduced expression of PAC-1 and CD62p in patients with malignant lymphoma.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18600034 Induction of hypercortisolism in healthy volunteers was not associated with changes in the platelet activation marker PAC-1 or the number of circulating platelet-leucocyte aggregates.
More...

AA Sequence

MGLEAARELECAALGTLLRDPREAERTLLLDCRPFLAFCRRHVRAARPVPWNALLRRRARGPPAAVLACL      1 - 70
LPDRALRTRLVRGELARAVVLDEGSASVAELRPDSPAHVLLAALLHETRAGPTAVYFLRGGFDGFQGCCP     71 - 140
DLCSEAPAPALPPTGDKTSRSDSRAPVYDQGGPVEILPYLFLGSCSHSSDLQGLQACGITAVLNVSASCP    141 - 210
NHFEGLFRYKSIPVEDNQMVEISAWFQEAIGFIDWVKNSGGRVLVHCQAGISRSATICLAYLMQSRRVRL    211 - 280
DEAFDFVKQRRGVISPNFSFMGQLLQFETQVLCH                                        281 - 314
//

Text Mined References (27)

PMID Year Title
26833217 2016 The dual specificity phosphatase 2 gene is hypermethylated in human cancer and regulated by epigenetic mechanisms.
26658840 2016 Highly recurrent mutations of SGK1, DUSP2 and JUNB in nodular lymphocyte predominant Hodgkin lymphoma.
26207425 2015 Brief Exercises Affect Gene Expression in Circulating Monocytes.
25596742 2015 Hypoxia/HIF1? induces lapatinib resistance in ERBB2-positive breast cancer cells via regulation of DUSP2.
21984126 2011 Hypoxia-inhibited dual-specificity phosphatase-2 expression in endometriotic cells regulates cyclooxygenase-2 expression.
21784977 2011 Zinc finger protein tristetraprolin interacts with CCL3 mRNA and regulates tissue inflammation.
21490398 2011 Suppression of dual-specificity phosphatase-2 by hypoxia increases chemoresistance and malignancy in human cancer cells.
20723301 2010 [Influence of dipyridamole on expression of PAC-1 and CD62p in patients with malignant lymphoma].
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...