Property Summary

NCBI Gene PubMed Count 26
Grant Count 12
R01 Count 5
Funding $592,248.37
PubMed Score 5.59
PubTator Score 7.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.392 0.000
lung cancer 1.300 0.010
group 3 medulloblastoma 1.200 0.003
acute myeloid leukemia -1.100 0.014
ovarian cancer 1.200 0.001

Gene RIF (8)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19124506 Observational study of gene-disease association. (HuGE Navigator)
18842000 characterize the BARD1 structural biochemistry responsible for CstF-50 binding
18676680 Observational study of gene-disease association. (HuGE Navigator)
15878232 A deletion variant of BARD1, a BRCA1 partner, occurs in cells and interacts with and colocalizes with CstF-50.

AA Sequence

MYRTKVGLKDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMENDDTAVQYAIG      1 - 70
RSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERM     71 - 140
LAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTEQILASGSRDYTLKLFDYSKPSAKRA    141 - 210
FKYIQEAEMLRSISFHPSGDFILVGTQHPTLRLYDINTFQCFVSCNPQDQHTDAICSVNYNSSANMYVTG    211 - 280
SKDGCIKLWDGVSNRCITTFEKAHDGAEVCSAIFSKNSKYILSSGKDSVAKLWEISTGRTLVRYTGAGLS    281 - 350
GRQVHRTQAVFNHTEDYVLLPDERTISLCCWDSRTAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFR    351 - 420
ARFWYRRSTTD                                                               421 - 431
//

Text Mined References (28)

PMID Year Title
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
18842000 2008 The BARD1 C-terminal domain structure and interactions with polyadenylation factor CstF-50.
More...