Property Summary

NCBI Gene PubMed Count 12
PubMed Score 51.66
PubTator Score 11.59

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
posterior fossa group A ependymoma -1.100 9.1e-07
primitive neuroectodermal tumor -1.200 3.6e-04

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MFQPAAKRGFTIESLVAKDGGTGGGTGGGGAGSHLLAAAASEEPLRPTALNYPHPSAAEAAFVSGFPAAA      1 - 70
AAGAGRSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHRDPLHFYPWVLRNRFFGHRFQ     71 - 140
ASDVPQDGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSLSLSETQVKVWFQNR    141 - 210
RTKYKRQKLEEEGPESEQKKKGSHHINRWRIATKQANGEDIDVTSND                           211 - 257
//

Text Mined References (12)

PMID Year Title