Property Summary

NCBI Gene PubMed Count 12
Grant Count 30
R01 Count 25
Funding $4,012,596.62
PubMed Score 60.34
PubTator Score 11.59

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
primitive neuroectodermal tumor -1.200 0.000
posterior fossa group A ependymoma -1.100 0.000

Gene RIF (1)

PMID Text
20016109 An intersectional fate-mapping analysis reveals that transgenic Emx1-lineage cells coexpressing Dlx exclusively generate medium spiny neurons but do not contribute to the excitatory neurons in the amygdala.

AA Sequence

MFQPAAKRGFTIESLVAKDGGTGGGTGGGGAGSHLLAAAASEEPLRPTALNYPHPSAAEAAFVSGFPAAA      1 - 70
AAGAGRSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHRDPLHFYPWVLRNRFFGHRFQ     71 - 140
ASDVPQDGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSLSLSETQVKVWFQNR    141 - 210
RTKYKRQKLEEEGPESEQKKKGSHHINRWRIATKQANGEDIDVTSND                           211 - 257
//

Text Mined References (12)

PMID Year Title
20887964 2010 WDR11, a WD protein that interacts with transcription factor EMX1, is mutated in idiopathic hypogonadotropic hypogonadism and Kallmann syndrome.
20016109 2009 Emx1-lineage progenitors differentially contribute to neural diversity in the striatum and amygdala.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10669604 2000 Bacteriophage lambda display of complex cDNA libraries: a new approach to functional genomics.
8843394 1996 EMX1 homeoprotein is expressed in cell nuclei of the developing cerebral cortex and in the axons of the olfactory sensory neurons.
7959790 1994 Chromosome locations of human EMX and OTX genes.
More...