Property Summary

NCBI Gene PubMed Count 150
Grant Count 216
R01 Count 137
Funding $18,583,119.74
PubMed Score 389.70
PubTator Score 454.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.200 0.006
glioblastoma 1.300 0.000
medulloblastoma, large-cell 1.100 0.002
Amyotrophic Lateral Sclerosis -1.095 0.000
non-small cell lung cancer 1.159 0.000
aldosterone-producing adenoma -1.046 0.043
gastric carcinoma 1.100 0.043
ovarian cancer 1.900 0.000

Synonym

Accession Q04637 D3DNT2 D3DNT4 D3DNT5 E9PFM1 G5E9S1 O43177 O95066 Q5HYG0 Q6ZN21 Q8N102 eIF-4-gamma 1
Symbols P220
EIF4F
EIF4G
EIF4GI
PARK18
EIF-4G1

Gene

PDB

4F02   1LJ2   1UG3   2W97   4AZA   5EHC  

 MGI Term (1)

 GWAS Trait (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
782 screening 801 / 0 / 216715 uHTS for Small Molecule Inhibitors of Eukaryotic Translation Initiation
855 confirmatory 78 / 0 / 486 Dose Response Confirmation for Small Molecule Inhibitors of Eukaryotic Translation Initiation

Gene RIF (101)

PMID Text
26300542 VPS35 D620N and EIF4G1 R1205H mutations are not a common cause of Parkinson disease in the Greek population.
26170285 the C-terminal extension (motif 3) is critical to 4E-BP1-mediated cell cycle arrest and it partially overlaps with the binding site of 4EGI-1
26022768 EIF4G1 mutations are not related to Parkinson's disease
25738462 EIF4GI shares this activity and also interacts with eIF1.
25717031 This study is the first to directly assess the relative contribution of eIF4F components to the expressed cellular proteome, transcription factors, microRNAs, and phenotype in multiple myeloma
25631074 Cellular biotinylated eukaryotic translation initiation factor 4 gamma, 1 (EIF4G1) protein is incorporated into HIV-1 Gag virus-like particles
25593313 This study therefore implicates c-Myc as a potential regulator of the cancer-promoting effects of equol via up-regulation of eIF4GI and selective initiation of translation on mRNAs that utilize non-canonical initiation, including certain oncogenes
25368108 EIF4G1 is neither a strong nor a common risk factor for Parkinson's disease: evidence from large European cohorts.
25255371 Data suggest that, in eIF4G/eif4A complex, eIF4G1 exhibits low-affinity ATP binding site in proximity of ATP-binding cleft of eif4A enhancing ATP binding; additional enhancement of eIF4G/eif4A binding is observed in crowded/intracellular environment.
25049413 The eIF4E/eIF4G inhibitor 4EGI-1 acts allosterically by binding to a site on eIF4E distant from the eIF4G binding epitope.
More...

AA Sequence

MNKAPQSTGPPPAPSPGLPQPAFPPGQTAPVVFSTPQATQMNTPSQPRQHFYPSRAQPPSSAASRVQSAA      1 - 70
PARPGPAAHVYPAGSQVMMIPSQISYPASQGAYYIPGQGRSTYVVPTQQYPVQPGAPGFYPGASPTEFGT     71 - 140
YAGAYYPAQGVQQFPTGVAPTPVLMNQPPQIAPKRERKTIRIRDPNQGGKDITEEIMSGARTASTPTPPQ    141 - 210
TGGGLEPQANGETPQVAVIVRPDDRSQGAIIADRPGLPGPEHSPSESQPSSPSPTPSPSPVLEPGSEPNL    211 - 280
AVLSIPGDTMTTIQMSVEESTPISRETGEPYRLSPEPTPLAEPILEVEVTLSKPVPESEFSSSPLQAPTP    281 - 350
LASHTVEIHEPNGMVPSEDLEPEVESSPELAPPPACPSESPVPIAPTAQPEELLNGAPSPPAVDLSPVSE    351 - 420
PEEQAKEVTASMAPPTIPSATPATAPSATSPAQEEEMEEEEEEEEGEAGEAGEAESEKGGEELLPPESTP    421 - 490
IPANLSQNLEAAAATQVAVSVPKRRRKIKELNKKEAVGDLLDAFKEANPAVPEVENQPPAGSNPGPESEG    491 - 560
SGVPPRPEEADETWDSKEDKIHNAENIQPGEQKYEYKSDQWKPLNLEEKKRYDREFLLGFQFIFASMQKP    561 - 630
EGLPHISDVVLDKANKTPLRPLDPTRLQGINCGPDFTPSFANLGRTTLSTRGPPRGGPGGELPRGPAGLG    631 - 700
PRRSQQGPRKEPRKIIATVLMTEDIKLNKAEKAWKPSSKRTAADKDRGEEDADGSKTQDLFRRVRSILNK    701 - 770
LTPQMFQQLMKQVTQLAIDTEERLKGVIDLIFEKAISEPNFSVAYANMCRCLMALKVPTTEKPTVTVNFR    771 - 840
KLLLNRCQKEFEKDKDDDEVFEKKQKEMDEAATAEERGRLKEELEEARDIARRRSLGNIKFIGELFKLKM    841 - 910
LTEAIMHDCVVKLLKNHDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIIKEKKTSSRIRFMLQ    911 - 980
DVLDLRGSNWVPRRGDQGPKTIDQIHKEAEMEEHREHIKVQQLMAKGSDKRRGGPPGPPISRGLPLVDDG    981 - 1050
GWNTVPISKGSRPIDTSRLTKITKPGSIDSNNQLFAPGGRLSWGKGSSGGSGAKPSDAASEAARPATSTL   1051 - 1120
NRFSALQQAVPTESTDNRRVVQRSSLSRERGEKAGDRGDRLERSERGGDRGDRLDRARTPATKRSFSKEV   1121 - 1190
EERSRERPSQPEGLRKAASLTEDRDRGRDAVKREAALPPVSPLKAALSEEELEKKSKAIIEEYLHLNDMK   1191 - 1260
EAVQCVQELASPSLLFIFVRHGVESTLERSAIAREHMGQLLHQLLCAGHLSTAQYYQGLYEILELAEDME   1261 - 1330
IDIPHVWLYLAELVTPILQEGGVPMGELFREITKPLRPLGKAASLLLEILGLLCKSMGPKKVGTLWREAG   1331 - 1400
LSWKEFLPEGQDIGAFVAEQKVEYTLGEESEAPGQRALPSEELNRQLEKLLKEGSSNQRVFDWIEANLSE   1401 - 1470
QQIVSNTLVRALMTAVCYSAIIFETPLRVDVAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQPPN   1471 - 1540
LLRMFFDALYDEDVVKEDAFYSWESSKDPAEQQGKGVALKSVTAFFKWLREAEEESDHN              1541 - 1599
//

Text Mined References (170)

PMID Year Title
26300542 2015 D620N mutation in the VPS35 gene and R1205H mutation in the EIF4G1 gene are uncommon in the Greek population.
26170285 2015 Molecular mechanism of the dual activity of 4EGI-1: Dissociating eIF4G from eIF4E but stabilizing the binding of unphosphorylated 4E-BP1.
26022768 2015 EIF4G1 mutations do not cause Parkinson's disease.
25765080 2015 The EIF4G1 gene and Parkinson's disease.
25738462 2015 Translational tolerance of mitochondrial genes to metabolic energy stress involves TISU and eIF1-eIF4GI cooperation in start codon selection.
25717031 2015 eIF4E and eIF4GI have distinct and differential imprints on multiple myeloma's proteome and signaling.
25593313 2015 Equol, an isoflavone metabolite, regulates cancer cell viability and protein synthesis initiation via c-Myc and eIF4G.
25533483 2015 Parkinson's disease genes VPS35 and EIF4G1 interact genetically and converge on ?-synuclein.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25368108 2015 EIF4G1 is neither a strong nor a common risk factor for Parkinson's disease: evidence from large European cohorts.
More...