Property Summary

NCBI Gene PubMed Count 43
PubMed Score 289.29
PubTator Score 102.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Glycogen storage disease IV 6 0.0 5.0
Disease Target Count Z-score Confidence
Glycogen storage disease 39 6.066 3.0
Neuropathy 261 0.0 4.0

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma 1.800 1.2e-02
breast carcinoma -1.300 8.0e-03
ductal carcinoma in situ -1.200 8.3e-03
fibroadenoma -1.700 2.6e-02
glioblastoma 2.400 2.2e-03
invasive ductal carcinoma -1.900 2.9e-03
Multiple myeloma 1.061 8.5e-03
ovarian cancer -1.900 7.7e-06
pancreatic ductal adenocarcinoma liver m... -1.463 8.0e-03
subependymal giant cell astrocytoma 1.711 1.6e-02
Waldenstrons macroglobulinemia 1.162 1.7e-02

Protein-protein Interaction (2)

Gene RIF (22)

AA Sequence

MAAPMTPAARPEDYEAALNAALADVPELARLLEIDPYLKPYAVDFQRRYKQFSQILKNIGENEGGIDKFS      1 - 70
RGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVPHGS     71 - 140
KLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDPEHSYEFKHSRPKKPRSLRIYESHVGISSHE    141 - 210
GKVASYKHFTCNVLPRIKGLGYNCIQLMAIMEHAYYASFGYQITSFFAASSRYGTPEELQELVDTAHSMG    211 - 280
IIVLLDVVHSHASKNSADGLNMFDGTDSCYFHSGPRGTHDLWDSRLFAYSSWEILRFLLSNIRWWLEEYR    281 - 350
FDGFRFDGVTSMLYHHHGVGQGFSGDYSEYFGLQVDEDALTYLMLANHLVHTLCPDSITIAEDVSGMPAL    351 - 420
CSPISQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGDIVYTLTNRRYLEKCIAYAESHDQALVGDKSL    421 - 490
AFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMGNEFGHPEWLDFPRKGNNESY    491 - 560
HYARRQFHLTDDDLLRYKFLNNFDRDMNRLEERYGWLAAPQAYVSEKHEGNKIIAFERAGLLFIFNFHPS    561 - 630
KSYTDYRVGTALPGKFKIVLDSDAAEYGGHQRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVALILQNVDL    631 - 700
PN                                                                        701 - 702
//

Text Mined References (44)

PMID Year Title