Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00
PubTator Score 832.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 3.5e-36
ovarian cancer 8520 8.5e-08
chronic rhinosinusitis 512 2.9e-02

Expression

  Differential Expression (3)

Disease log2 FC p
chronic rhinosinusitis 1.631 2.9e-02
ovarian cancer 1.100 8.5e-08
psoriasis -2.400 3.5e-36

Gene RIF (1)

AA Sequence

MLLILLSVALLALSSAQSLNEDVSQEESPSVISGKPEGRRPQGGNQPQRTPPPPGKPEGRPPQGGNQSQG      1 - 70
PPPRPGKPEGPPPQGGNQSQGPPPRPGKPEGQPPQGGNQSQGPPPRPGKPEGPPPQGGNQSQGPPPRPGK     71 - 140
PEGPPPQGGNQSQGPPPHPGKPEGPPPQGGNQSQGPPPRPGKPEGPPPQGGNQSQGPPPRPGKPEGPPPQ    141 - 210
GGNQSQGPPPRPGKPEGSPSQGGNKPQGPPPHPGKPQGPPPQEGNKPQRPPPPGRPQGPPPPGGNPQQPL    211 - 280
PPPAGKPQGPPPPPQGGRPHRPPQGQPPQ                                             281 - 309
//

Text Mined References (14)

PMID Year Title