Tbio | Basic salivary proline-rich protein 3 |
Acts as a receptor for the Gram-negative bacterium F.nucleatum.
This gene encodes a member of the heterogeneous family of basic, proline-rich, human salivary glycoproteins. Multiple alleles of this gene exhibiting variations in the length of the tandem repeats have been identified. The reference genome encodes the "Long" allele. The protein isoforms encoded by this gene are recognized as the "first line of oral defense" against the detrimental effects of polyphenols in the diet and pathogen infections. This gene is located in a cluster of closely related salivary proline-rich proteins on chromosome 12. [provided by RefSeq, Nov 2015]
This gene encodes a member of the heterogeneous family of basic, proline-rich, human salivary glycoproteins. Multiple alleles of this gene exhibiting variations in the length of the tandem repeats have been identified. The reference genome encodes the "Long" allele. The protein isoforms encoded by this gene are recognized as the "first line of oral defense" against the detrimental effects of polyphenols in the diet and pathogen infections. This gene is located in a cluster of closely related salivary proline-rich proteins on chromosome 12. [provided by RefSeq, Nov 2015]
Comments
Disease | Target Count | P-value |
---|---|---|
psoriasis | 6685 | 3.51331785942886E-36 |
ovarian cancer | 8492 | 8.511884137614E-8 |
chronic rhinosinusitis | 512 | 0.0289535215438542 |
Disease | log2 FC | p |
---|---|---|
ovarian cancer | 1.100 | 0.000 |
chronic rhinosinusitis | 1.631 | 0.029 |
psoriasis | -2.400 | 0.000 |
PMID | Text |
---|---|
24135847 | The results of this study suggested that low levels of PRB3 mRNA may have a role in dopamine-agonist resistance and tumor recurrence of prolactinomas. |
MLLILLSVALLALSSAQSLNEDVSQEESPSVISGKPEGRRPQGGNQPQRTPPPPGKPEGRPPQGGNQSQG 1 - 70 PPPRPGKPEGPPPQGGNQSQGPPPRPGKPEGQPPQGGNQSQGPPPRPGKPEGPPPQGGNQSQGPPPRPGK 71 - 140 PEGPPPQGGNQSQGPPPHPGKPEGPPPQGGNQSQGPPPRPGKPEGPPPQGGNQSQGPPPRPGKPEGPPPQ 141 - 210 GGNQSQGPPPRPGKPEGSPSQGGNKPQGPPPHPGKPQGPPPQEGNKPQRPPPPGRPQGPPPPGGNPQQPL 211 - 280 PPPAGKPQGPPPPPQGGRPHRPPQGQPPQ 281 - 309 //
PMID | Year | Title |
---|---|---|
26375204 | 2016 | The intriguing heterogeneity of human salivary proline-rich proteins: Short title: Salivary proline-rich protein species. |
24135847 | 2014 | Low levels of PRB3 mRNA are associated with dopamine-agonist resistance and tumor recurrence in prolactinomas. |
20879038 | 2010 | Finding new posttranslational modifications in salivary proline-rich proteins. |
18463091 | 2008 | Identification of Lys-Pro-Gln as a novel cleavage site specificity of saliva-associated proteases. |
15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. |
10737800 | 2000 | Shotgun sequencing of the human transcriptome with ORF expressed sequence tags. |
8406834 | 1993 | PRB3 null mutations result in absence of the proline-rich glycoprotein Gl and abolish Fusobacterium nucleatum interactions with saliva in vitro. |
7566098 | 1995 | Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence. |
3055850 | 1988 | Molecular genetics of human salivary proteins and their polymorphisms. |
More... |