Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00
PubTator Score 832.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
ovarian cancer 1.100 0.000
chronic rhinosinusitis 1.631 0.029
psoriasis -2.400 0.000

Gene RIF (1)

PMID Text
24135847 The results of this study suggested that low levels of PRB3 mRNA may have a role in dopamine-agonist resistance and tumor recurrence of prolactinomas.

AA Sequence

MLLILLSVALLALSSAQSLNEDVSQEESPSVISGKPEGRRPQGGNQPQRTPPPPGKPEGRPPQGGNQSQG      1 - 70
PPPRPGKPEGPPPQGGNQSQGPPPRPGKPEGQPPQGGNQSQGPPPRPGKPEGPPPQGGNQSQGPPPRPGK     71 - 140
PEGPPPQGGNQSQGPPPHPGKPEGPPPQGGNQSQGPPPRPGKPEGPPPQGGNQSQGPPPRPGKPEGPPPQ    141 - 210
GGNQSQGPPPRPGKPEGSPSQGGNKPQGPPPHPGKPQGPPPQEGNKPQRPPPPGRPQGPPPPGGNPQQPL    211 - 280
PPPAGKPQGPPPPPQGGRPHRPPQGQPPQ                                             281 - 309
//

Text Mined References (14)

PMID Year Title
26375204 2016 The intriguing heterogeneity of human salivary proline-rich proteins: Short title: Salivary proline-rich protein species.
24135847 2014 Low levels of PRB3 mRNA are associated with dopamine-agonist resistance and tumor recurrence in prolactinomas.
20879038 2010 Finding new posttranslational modifications in salivary proline-rich proteins.
18463091 2008 Identification of Lys-Pro-Gln as a novel cleavage site specificity of saliva-associated proteases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
8406834 1993 PRB3 null mutations result in absence of the proline-rich glycoprotein Gl and abolish Fusobacterium nucleatum interactions with saliva in vitro.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.
3055850 1988 Molecular genetics of human salivary proteins and their polymorphisms.
More...