Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.13
PubTator Score 6.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.116 0.000
medulloblastoma, large-cell -1.500 0.000
tuberculosis -1.500 0.000
group 4 medulloblastoma -1.300 0.000
non-inflammatory breast cancer -2.500 0.000
lung carcinoma -1.200 0.000

Synonym

Accession Q03989 Q6NX37 ARID domain-containing protein 5A
Symbols MRF1
MRF-1
RP11-363D14

Gene

Gene RIF (2)

PMID Text
24782182 AT-rich-interactive domain-containing protein 5A functions as a negative regulator of retinoic acid receptor-related orphan nuclear receptor gammat-induced Th17 cell differentiation.
18854154 Knockdown of AT rich interactive domain 5A (ARID5A) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MAAPVKGNRKQSTEGDALDPPASPKPAGKQNGIQNPISLEDSPEAGGEREEEQEREEEQAFLVSLYKFMK      1 - 70
ERHTPIERVPHLGFKQINLWKIYKAVEKLGAYELVTGRRLWKNVYDELGGSPGSTSAATCTRRHYERLVL     71 - 140
PYVRHLKGEDDKPLPTSKPRKQYKMAKENRGDDGATERPKKAKEERRMDQMMPGKTKADAADPAPLPSQE    141 - 210
PPRNSTEQQGLASGSSVSFVGASGCPEAYKRLLSSFYCKGTHGIMSPLAKKKLLAQVSKVEALQCQEEGC    211 - 280
RHGAEPQASPAVHLPESPQSPKGLTENSRHRLTPQEGLQAPGGSLREEAQAGPCPAAPIFKGCFYTHPTE    281 - 350
VLKPVSQHPRDFFSRLKDGVLLGPPGKEGLSVKEPQLVWGGDANRPSAFHKGGSRKGILYPKPKACWVSP    351 - 420
MAKVPAESPTLPPTFPSSPGLGSKRSLEEEGAAHSGKRLRAVSPFLKEADAKKCGAKPAGSGLVSCLLGP    421 - 490
ALGPVPPEAYRGTMLHCPLNFTGTPGPLKGQAALPFSPLVIPAFPAHFLATAGPSPMAAGLMHFPPTSFD    491 - 560
SALRHRLCPASSAWHAPPVTTYAAPHFFHLNTKL                                        561 - 594
//

Text Mined References (10)

PMID Year Title
24782182 2014 AT-rich-interactive domain-containing protein 5A functions as a negative regulator of retinoic acid receptor-related orphan nuclear receptor ?t-induced Th17 cell differentiation.
23275563 2013 Development and application of a DNA microarray-based yeast two-hybrid system.
21184583 2011 Genome-wide association study of theta band event-related oscillations identifies serotonin receptor gene HTR7 influencing risk of alcohol dependence.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15640446 2005 DNA-binding properties of ARID family proteins.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8649988 1996 Repression by a differentiation-specific factor of the human cytomegalovirus enhancer.