Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.22
PubTator Score 6.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Breast cancer 3578 6.6e-28
lung carcinoma 2843 5.4e-08
medulloblastoma, large-cell 6241 1.1e-05
tuberculosis 2010 1.3e-05
osteosarcoma 7950 8.1e-05
group 4 medulloblastoma 1855 1.7e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
substance-related disorder 162 0.0 1.1

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer -1.900 6.6e-28
group 4 medulloblastoma -1.300 1.7e-04
lung carcinoma -1.200 5.4e-08
medulloblastoma, large-cell -1.500 1.1e-05
osteosarcoma -1.116 8.1e-05
tuberculosis -1.500 1.3e-05

Gene RIF (2)

AA Sequence

MAAPVKGNRKQSTEGDALDPPASPKPAGKQNGIQNPISLEDSPEAGGEREEEQEREEEQAFLVSLYKFMK      1 - 70
ERHTPIERVPHLGFKQINLWKIYKAVEKLGAYELVTGRRLWKNVYDELGGSPGSTSAATCTRRHYERLVL     71 - 140
PYVRHLKGEDDKPLPTSKPRKQYKMAKENRGDDGATERPKKAKEERRMDQMMPGKTKADAADPAPLPSQE    141 - 210
PPRNSTEQQGLASGSSVSFVGASGCPEAYKRLLSSFYCKGTHGIMSPLAKKKLLAQVSKVEALQCQEEGC    211 - 280
RHGAEPQASPAVHLPESPQSPKGLTENSRHRLTPQEGLQAPGGSLREEAQAGPCPAAPIFKGCFYTHPTE    281 - 350
VLKPVSQHPRDFFSRLKDGVLLGPPGKEGLSVKEPQLVWGGDANRPSAFHKGGSRKGILYPKPKACWVSP    351 - 420
MAKVPAESPTLPPTFPSSPGLGSKRSLEEEGAAHSGKRLRAVSPFLKEADAKKCGAKPAGSGLVSCLLGP    421 - 490
ALGPVPPEAYRGTMLHCPLNFTGTPGPLKGQAALPFSPLVIPAFPAHFLATAGPSPMAAGLMHFPPTSFD    491 - 560
SALRHRLCPASSAWHAPPVTTYAAPHFFHLNTKL                                        561 - 594
//

Text Mined References (14)

PMID Year Title