Property Summary

NCBI Gene PubMed Count 48
PubMed Score 13.29
PubTator Score 64.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3232 4.4e-07
acute quadriplegic myopathy 1158 5.3e-07
ovarian cancer 8520 1.6e-06
psoriasis 6694 1.7e-05
lung cancer 4740 1.4e-04
osteosarcoma 7950 5.6e-03
group 3 medulloblastoma 4104 2.7e-02
Disease Target Count Z-score Confidence
Heart disease 306 0.0 3.0

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.356 5.3e-07
group 3 medulloblastoma 1.300 2.7e-02
lung cancer 1.900 1.4e-04
malignant mesothelioma 1.400 4.4e-07
osteosarcoma 1.977 5.6e-03
ovarian cancer -1.500 1.6e-06
psoriasis -2.300 1.7e-05

Gene RIF (29)

AA Sequence

MKQSSNVPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMYGF      1 - 70
RKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKVSSSKPEENKIRQEDLTKIISSAQKVQIKQ     71 - 140
ETIESRLSELKSENESLWKEVSELRAKHAQQQQVIRKIVQFIVTLVQNNQLVSLKRKRPLLLNTNGAQKK    141 - 210
NLFQHIVKEPTDNHHHKVPHSRTEGLKPRERISDDIIIYDVTDDNADEENIPVIPETNEDVISDPSNCSQ    211 - 280
YPDIVIVEDDNEDEYAPVIQSGEQNEPARESLSSGSDGSSPLMSSAVQLNGSSSLTSEDPVTMMDSILND    281 - 350
NINLLGKVELLDYLDSIDCSLEDFQAMLSGRQFSIDPDLLVDLFTSSVQMNPTDYINNTKSENKGLETTK    351 - 420
NNVVQPVSEEGRKSKSKPDKQLIQYTAFPLLAFLDGNPASSVEQASTTASSEVLSSVDKPIEVDELLDSS    421 - 490
LDPEPTQSKLVRLEPLTEAEASEATLFYLCELAPAPLDSDMPLLDS                            491 - 536
//

Text Mined References (53)

PMID Year Title