Property Summary

NCBI Gene PubMed Count 44
Grant Count 34
R01 Count 18
Funding $2,162,293.76
PubMed Score 12.79
PubTator Score 64.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
psoriasis -2.300 0.000
osteosarcoma 1.977 0.006
group 4 medulloblastoma 1.700 0.000
acute quadriplegic myopathy 1.356 0.000
lung cancer 2.300 0.000
ovarian cancer -1.500 0.000

Gene RIF (27)

PMID Text
26727490 Presented are the crystal structures of the human HSF2 DNA-binding domain (DBD) bound to DNA.
26478434 HSF2 can induce histone activation.Set1/MLL complex is indispensable for the transcriptional ability of HSF2.
26260034 the findings of our studys suggest that HSF2 contributes to its own expression by forming a negative autoregulatory loop.
26119944 This study provides the first evidence for HSF2 acting as a suppressor of invasion in human malignancies.
26003728 Nuclear HSF2 and HSF4 bound to HSF1 only after heat shock.
25202032 the condensed chromatin of HSF2-deficient cells is accessible for HSF1 and RNA polymerase II, allowing stress-inducible Hsp expression.
24619424 Data indicate that both heat shock factors HSF1 and HSF2 are recruited to the arsenite-inducible RNA-associated protein (AIRAP) promoter and regulate bortezomib-induced AIRAP expression.
24533153 HSF2 appears to be a potential novel molecular marker for ulcerative colitis
23959860 Results indicate the importance of the cell cycle phase in transcriptional responses and identify the specific mechanisms for HSF1 and HSF2 in transcriptional orchestration.
23064888 These results support a role for HSF2 in the pathogenesis of IA and further implicate this transcription factor as a potential therapeutic target.
More...

AA Sequence

MKQSSNVPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMYGF      1 - 70
RKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKVSSSKPEENKIRQEDLTKIISSAQKVQIKQ     71 - 140
ETIESRLSELKSENESLWKEVSELRAKHAQQQQVIRKIVQFIVTLVQNNQLVSLKRKRPLLLNTNGAQKK    141 - 210
NLFQHIVKEPTDNHHHKVPHSRTEGLKPRERISDDIIIYDVTDDNADEENIPVIPETNEDVISDPSNCSQ    211 - 280
YPDIVIVEDDNEDEYAPVIQSGEQNEPARESLSSGSDGSSPLMSSAVQLNGSSSLTSEDPVTMMDSILND    281 - 350
NINLLGKVELLDYLDSIDCSLEDFQAMLSGRQFSIDPDLLVDLFTSSVQMNPTDYINNTKSENKGLETTK    351 - 420
NNVVQPVSEEGRKSKSKPDKQLIQYTAFPLLAFLDGNPASSVEQASTTASSEVLSSVDKPIEVDELLDSS    421 - 490
LDPEPTQSKLVRLEPLTEAEASEATLFYLCELAPAPLDSDMPLLDS                            491 - 536
//

Text Mined References (48)

PMID Year Title
26727490 2016 Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors.
26478434 2015 Set1/MLL complex is indispensable for the transcriptional ability of heat shock transcription factor 2.
26260034 2015 HSF2 autoregulates its own transcription.
26119944 2016 Heat-shock factor 2 is a suppressor of prostate cancer invasion.
26003728 2015 Heat shock-induced interactions among nuclear HSFs detected by fluorescence cross-correlation spectroscopy.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25241763 2014 Meta-analysis of genome-wide association studies identifies novel loci that influence cupping and the glaucomatous process.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
More...