Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.10
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma 1.300 1.4e-03
astrocytic glioma 1.300 1.9e-02
atypical teratoid / rhabdoid tumor 1.700 4.6e-05
colon cancer 1.100 3.3e-02
ependymoma 1.600 3.4e-02
glioblastoma 1.200 3.5e-06
group 3 medulloblastoma 1.900 3.9e-04
intraductal papillary-mucinous carcinoma... 1.500 3.6e-02
lung cancer -2.800 9.8e-05
medulloblastoma, large-cell 1.300 4.2e-04
oligodendroglioma 1.300 5.3e-14
osteosarcoma -2.172 5.2e-04
ovarian cancer 1.200 1.5e-04
pituitary cancer 1.100 1.2e-03
primitive neuroectodermal tumor 1.600 7.7e-04
psoriasis -2.000 9.1e-05
tuberculosis 1.100 1.4e-05

Gene RIF (1)

AA Sequence

MKRHEMVAKHLVMFYYFAQHLWPEQNIRDSFQKVTLRRYRKCGYENLQLRKGCKSVVECKQHKGDYSGLN      1 - 70
QCLKTTLSKIFQCNKYVEVFHKISNSNRHKMRHTENKHFKCKECRKTFCMLSHLTQHKRIQTRVNFYKCE     71 - 140
AYGRAFNWSSTLNKHKRIHTGEKPYKCKECGKAFNQTSHLIRHKRIHTEEKPYKCEECGKAFNQSSTLTT    141 - 210
HNIIHTGEIPYKCEKCVRAFNQASKLTEHKLIHTGEKRYECEECGKAFNRSSKLTEHKYIHTGEKLYKCE    211 - 280
ECGKAFNQSSTLTTHKRIHSGEKPYKCEECGKAFKQFSNLTDHKKIHTGEKPYKCEECGKAFNQLSNLTR    281 - 350
HKVIHTGEKPYKCGECGKAFNQSSALNTHKIIHTGENPHKCRESGKVFHLSSKLSTCKKIHTGEKLYKCE    351 - 420
ECGKAFNRSSTLIGHKRIHTGEKPYKCEECGKAFNQSSTLTTHKIIHTEEKQYKCDECGKAST           421 - 483
//

Text Mined References (7)

PMID Year Title