Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.59
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.35467170851492E-7
pituitary cancer 1972 7.96095497326178E-7
glioblastoma 5572 4.27563413645982E-6
cystic fibrosis 1670 8.69970509376551E-6
sonic hedgehog group medulloblastoma 1482 3.09645303653781E-5
pediatric high grade glioma 2712 1.97393902088374E-4
psoriasis 6685 2.90749531502855E-4
primitive neuroectodermal tumor 3031 0.00133480970474262
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00631922786773331
active Crohn's disease 918 0.0425546822709162
Disease Target Count Z-score Confidence
Varicocele 21 3.48 1.7

Expression

  Differential Expression (10)

Synonym

Accession Q03923 B9ZVP4 Q6NVI0
Symbols HPF4
HTF1

Gene

  Ortholog (1)

Species Source
Chimp OMA EggNOG

Pathway (1)

AA Sequence

MGPLTFRDVAIEFSLKEWQCLDTAQRNLYRNVMLENYRNLVFLGITVSKPDLITCLEQGKEAWSMKRHEI      1 - 70
MVAKPTVMCSHFAQDLWPEQNIKDSFQKVTLKRYGKCRHENLPLRKGCESMDECKMHKGGCNGLNQCLTA     71 - 140
TQSKIFQCDKYVKVAHKFSNSNRHEIRHTKKKPFKCTKCGKSFGMISCLTEHSRIHTRVNFYKCEECGKA    141 - 210
FNWSSTLTKHKRIHTGEKPYKCEECGKAFNQSSNLIKHKKIHTGEKPYKCEECGKTFNRFSTLTTHKIIH    211 - 280
TGEKPYKCKECGKAFNRSSTLTTHRKIHTGEKPYKCEECGKAFKQSSNLTTHKIIHTGEKPYKCKKCGKA    281 - 350
FNQSAHLTTHEVIHTGEKPYKCEKCGKAFNHFSHLTTHKIIHTGEKPYKCKECGKAFKHSSTLTKHKIIH    351 - 420
TGEKPYKCKECEKAFNQSSKLTEHKKIHTGEKPYECEKCGKAFNQSSNLTRHKKSHTEEKPYKCEECGKG    421 - 490
FKWPSTLTIHKIIHTGEKPYKCEECGKAFNQSSKLTKHKKIHTGEKPYTCEECGKAFNQSSNLTKHKRIH    491 - 560
TGEKPYKCEECDKAFKWSSVLTKHKIIHTGEKLQI                                       561 - 595
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9839802 1998 Functional analysis of ZNF85 KRAB zinc finger protein, a member of the highly homologous ZNF91 family.
9406578 1998 Enhanced expression in seminoma of human zinc finger genes located on chromosome 19.
8467795 1993 Clustered organization of homologous KRAB zinc-finger genes with enhanced expression in human T lymphoid cells.
More...