Property Summary

NCBI Gene PubMed Count 76
PubMed Score 110.04
PubTator Score 149.33

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q03591 A8K465 Q3B774 Q9UJ17 FHR-1
Symbols CFHL
FHR1
HFL1
HFL2
CFHL1
H36-1
H36-2
CFHL1P
CFHR1P

Gene

PDB

3ZD2   4MUC  

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (63)

AA Sequence

MWLLVSVILISRISSVGGEATFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRI      1 - 70
TCTEEGWSPTPKCLRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGYRLQNNENNISCVERGWSTPPKC     71 - 140
RSTDTSCVNPPTVQNAHILSRQMSKYPSGERVRYECRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGP    141 - 210
PPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIAL    211 - 280
RWTAKQKLYLRTGESAEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR                        281 - 330
//

Text Mined References (76)

PMID Year Title