Property Summary

NCBI Gene PubMed Count 467
Grant Count 504
R01 Count 376
Funding $38,943,928.31
PubMed Score 1004.88
PubTator Score 1013.73

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q03405 A8K409 Q12876 Q15845 Q16887 Q6IB52 Q9BWT0 Q9NYC8 Q9UD69 Q9UEA6 Q9UM92 Q9UMV0 U-PAR
Symbols CD87
UPAR
URKR
U-PAR

Gene

PDB

2FD6   2I9B   3BT1   3BT2   3U73   4K24   1YWH   3U74   4QTI  

Gene RIF (429)

PMID Text
27078836 The present paper develops a mathematical model of cancer recurrence besed on UPAR serum concentration.
26846181 Significance of the urokinase-type plasminogen activator and its receptor in the progression of focal segmental glomerulosclerosis in clinical and mouse models.
26823748 uPAR expression is higher in normal pregnant women than that in patients with threatened abortion. uPAR promotes trophoblast migration and invasion during embryo implantation as well as plays a role in trophoblast differentiation into syntrophoblasts.
26764285 results show that cleaved uPAR forms are significantly increased in patients with advanced prostate cancer.
26718775 Hypoxia enhanced the endogenous uPAR mRNA and protein expression.HIF-1 protein bound the putative HIF-1 response element on the uPAR promoter.uPAR protein expression was detected in cervical cancer but not in normal cervix or CIN.
26697731 There was no statistically significant difference in the plasma SuPAR levels of psoriasis patients compared to the control group.
26577922 uPAR-VEGFR2 interaction is crucial for VEGF signaling in endothelial cells
26548921 This study examines the complexes of PAI-1 with tissue-type and urokinase-type plasminogen activator and vitronectin revealed by changes in the conformation and dynamics of the reactive center loop.
26527290 our data show that uPAR is required for efficient skin tumor formation
26504024 High cytoplasmic expression of uPAR is associated with cells of rectal cancer and metastases of perienteric lymph nodes.
More...

AA Sequence

MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHS      1 - 70
EKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSP     71 - 140
EEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLP    141 - 210
QNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSM    211 - 280
NHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT                   281 - 335
//

Text Mined References (471)

PMID Year Title
27078836 2016 Serum uPAR as Biomarker in Breast Cancer Recurrence: A Mathematical Model.
26846181 2016 Significance of the urokinase-type plasminogen activator and its receptor in the progression of focal segmental glomerulosclerosis in clinical and mouse models.
26823748 2015 Expression of uPAR in human trophoblast and its role in trophoblast invasion.
26764285 2016 Copenhagen uPAR prostate cancer (CuPCa) database: protocol and early results.
26718775 2016 Hypoxia inducible factor-1 mediates upregulation of urokinase-type plasminogen activator receptor gene transcription during hypoxia in cervical cancer cells.
26697731 2015 Plasma-soluble urokinase plasminogen activator receptor (suPAR) levels in psoriasis patients and correlation with disease severity.
26577922 2015 The interaction of uPAR with VEGFR2 promotes VEGF-induced angiogenesis.
26548921 2016 Distinct encounter complexes of PAI-1 with plasminogen activators and vitronectin revealed by changes in the conformation and dynamics of the reactive center loop.
26527290 2015 Urokinase Receptor Promotes Skin Tumor Formation by Preventing Epithelial Cell Activation of Notch1.
26504024 2015 Plasminogen Activation System in Rectal Adenocarcinoma.
More...