Property Summary

NCBI Gene PubMed Count 467
PubMed Score 1004.88
PubTator Score 1013.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 1.40504593398379E-14
malignant mesothelioma 3163 1.86973718021393E-7
ovarian cancer 8492 8.67597179467304E-7
cystic fibrosis 1670 9.20729458799895E-7
posterior fossa group A ependymoma 1511 2.37685957726888E-6
ulcerative colitis 2087 2.72981631782521E-6
lung cancer 4473 1.96326461243516E-5
hepatocellular carcinoma 550 2.05139839959706E-5
atypical teratoid / rhabdoid tumor 4369 2.64845433714774E-5
interstitial cystitis 2299 2.69656346736639E-4
glioblastoma 5572 0.00129278234065503
tuberculosis 1563 0.00167376193149306
pediatric high grade glioma 2712 0.00168950458822863
invasive ductal carcinoma 2950 0.00238919686562382
Barrett's esophagus 185 0.00248136398111762
ductal carcinoma in situ 1745 0.00273793444439977
inflammatory breast cancer 404 0.00362862409514877
colon cancer 1475 0.0103022622995865
primary pancreatic ductal adenocarcinoma 1271 0.014286696461776
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0156849392673699
esophageal adenocarcinoma 737 0.0176010007179145
mucosa-associated lymphoid tissue lymphoma 480 0.0222415669993019
pancreatic cancer 2300 0.0302095295971618
oligodendroglioma 2849 0.0328699810569481
acute myeloid leukemia 785 0.0437292164020557
gastric carcinoma 832 0.0471367584380256
Disease Target Count Z-score Confidence
Cancer 2346 5.469 2.7

Expression

Synonym

Accession Q03405 A8K409 Q12876 Q15845 Q16887 Q6IB52 Q9BWT0 Q9NYC8 Q9UD69 Q9UEA6 Q9UM92 Q9UMV0 U-PAR
Symbols CD87
UPAR
URKR
U-PAR

Gene

PDB

2FD6   2I9B   3BT1   3BT2   3U73   4K24   1YWH   3U74   4QTI  

  Ortholog (9)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG

Gene RIF (429)

PMID Text
27078836 The present paper develops a mathematical model of cancer recurrence besed on UPAR serum concentration.
26846181 Significance of the urokinase-type plasminogen activator and its receptor in the progression of focal segmental glomerulosclerosis in clinical and mouse models.
26823748 uPAR expression is higher in normal pregnant women than that in patients with threatened abortion. uPAR promotes trophoblast migration and invasion during embryo implantation as well as plays a role in trophoblast differentiation into syntrophoblasts.
26764285 results show that cleaved uPAR forms are significantly increased in patients with advanced prostate cancer.
26718775 Hypoxia enhanced the endogenous uPAR mRNA and protein expression.HIF-1 protein bound the putative HIF-1 response element on the uPAR promoter.uPAR protein expression was detected in cervical cancer but not in normal cervix or CIN.
26697731 There was no statistically significant difference in the plasma SuPAR levels of psoriasis patients compared to the control group.
26577922 uPAR-VEGFR2 interaction is crucial for VEGF signaling in endothelial cells
26548921 This study examines the complexes of PAI-1 with tissue-type and urokinase-type plasminogen activator and vitronectin revealed by changes in the conformation and dynamics of the reactive center loop.
26527290 our data show that uPAR is required for efficient skin tumor formation
26504024 High cytoplasmic expression of uPAR is associated with cells of rectal cancer and metastases of perienteric lymph nodes.
More...

AA Sequence

MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHS      1 - 70
EKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSP     71 - 140
EEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLP    141 - 210
QNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSM    211 - 280
NHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT                   281 - 335
//

Text Mined References (471)

PMID Year Title
27078836 2016 Serum uPAR as Biomarker in Breast Cancer Recurrence: A Mathematical Model.
26846181 2016 Significance of the urokinase-type plasminogen activator and its receptor in the progression of focal segmental glomerulosclerosis in clinical and mouse models.
26823748 2015 Expression of uPAR in human trophoblast and its role in trophoblast invasion.
26764285 2016 Copenhagen uPAR prostate cancer (CuPCa) database: protocol and early results.
26718775 2016 Hypoxia inducible factor-1 mediates upregulation of urokinase-type plasminogen activator receptor gene transcription during hypoxia in cervical cancer cells.
26697731 2015 Plasma-soluble urokinase plasminogen activator receptor (suPAR) levels in psoriasis patients and correlation with disease severity.
26577922 2015 The interaction of uPAR with VEGFR2 promotes VEGF-induced angiogenesis.
26548921 2016 Distinct encounter complexes of PAI-1 with plasminogen activators and vitronectin revealed by changes in the conformation and dynamics of the reactive center loop.
26527290 2015 Urokinase Receptor Promotes Skin Tumor Formation by Preventing Epithelial Cell Activation of Notch1.
26504024 2015 Plasminogen Activation System in Rectal Adenocarcinoma.
More...