Property Summary

Ligand Count 7
NCBI Gene PubMed Count 490
PubMed Score 1053.94
PubTator Score 1013.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
active ulcerative colitis 1.485 4.8e-02
acute myeloid leukemia 1.400 4.4e-02
adult high grade glioma 1.100 8.8e-03
atypical teratoid / rhabdoid tumor 1.500 2.6e-05
Barrett's esophagus 2.100 2.5e-03
colon cancer 1.900 1.0e-02
cystic fibrosis 1.953 9.2e-07
ductal carcinoma in situ 1.300 2.7e-03
esophageal adenocarcinoma 2.300 1.8e-02
gastric cancer -1.300 1.9e-03
glioblastoma 1.200 1.8e-03
hepatocellular carcinoma -1.300 2.1e-05
inflammatory breast cancer 1.200 3.6e-03
interstitial cystitis 2.000 2.7e-04
intraductal papillary-mucinous neoplasm ... 1.500 1.6e-02
invasive ductal carcinoma 1.700 2.4e-03
lung cancer -3.400 2.0e-05
lung carcinoma -1.900 1.4e-14
malignant mesothelioma -2.400 1.9e-07
mucosa-associated lymphoid tissue lympho... 1.053 2.2e-02
oligodendroglioma -1.100 3.3e-02
ovarian cancer 2.900 8.7e-07
pancreatic cancer 1.700 8.1e-07
pancreatic ductal adenocarcinoma liver m... 1.186 1.5e-02
posterior fossa group A ependymoma 1.200 2.4e-06
tuberculosis -1.800 2.2e-03

Gene RIF (452)

AA Sequence

MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHS      1 - 70
EKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSP     71 - 140
EEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLP    141 - 210
QNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSM    211 - 280
NHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT                   281 - 335
//

Text Mined References (494)

PMID Year Title