Property Summary

NCBI Gene PubMed Count 22
PubMed Score 102.66
PubTator Score 46.27

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

AA Sequence

MAPVLPLVLPLQPRIRLAQGLWLLSWLLALAGGVILLCSGHLLVQLRHLGTFLAPSCQFPVLPQAALAAG      1 - 70
AVALGTGLVGVGASRASLNAALYPPWRGVLGPLLVAGTAGGGGLLVVGLGLALALPGSLDEALEEGLVTA     71 - 140
LAHYKDTEVPGHCQAKRLVDELQLRYHCCGRHGYKDWFGVQWVSSRYLDPGDRDVADRIQSNVEGLYLTD    141 - 210
GVPFSCCNPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGTLGSMLAVTFLLQA    211 - 280
LVLLGLRYLQTALEGLGGVIDAGGETQGYLFPSGLKDMLKTAWLQGGVACRPAPEEAPPGEAPPKEDLSE    281 - 350
A//

Text Mined References (22)

PMID Year Title