Property Summary

NCBI Gene PubMed Count 102
Grant Count 166
R01 Count 99
Funding $30,008,114.88
PubMed Score 812.76
PubTator Score 510.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Gene

Gene RIF (69)

PMID Text
26601115 CREMalpha SNPs rs2295415 and rs1057108 may be novel genetic susceptibility factors for SLE, especially at haplotype level.
25401338 overexpressed in the nuclei of hepatocellular carcinoma cells
24943041 These findings indicated that the polymorphisms of CREM gene were associated with nonobstructive azoospermia in the Chinese population and low CREM expression might be involved in the pathogenesis of spermatogenesis maturation arrest.
24672804 Data suggest ICER/CREM plays seminal role in down-regulation of expression/secretion of insulin by pancreatic beta-cell as an adaptive response to factors that promote diabetes; inappropriate induction of ICER leads to beta-cell dysfunction. [REVIEW]
24667640 CaMK4-dependent activation of AKT/mTOR and CREM-alpha underlies autoimmunity-associated Th17 imbalance.
24297179 CREMalpha orchestrates epigenetic remodeling of the CD8A,B through the recruitment of DNA methyltransferase (DNMT) 3a and histone methyltransferase G9a.
24100545 In Alzheimer's brain, we found an increased cellular expression of CREM in dentate gyrus neurons as compared to normal aging brains.
24047902 transcription factor cAMP-responsive element modulator alpha (CREMalpha), which is expressed at increased levels in T cells from systemic lupus erythematosus patients, contributes to transcriptional silencing of CD8A and CD8B.
23929392 Data suggest that cyclic AMP response element modulator-1 (CREM-1) might play an important role in the regulation of tumor metastasis and invasion and serve as a tumor suppressor in esophageal squamous cell carcinoma (ESCC).
23124208 Increased CREMalpha binding to the Notch-1 promoter resulted in significantly reduced Notch-1 promoter activity and gene transcription.
More...

AA Sequence

MSKCARKKYIKTNPRQMTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVSVAGSGTRRGSPA      1 - 70
VTLVQLPSGQTIHVQGVIQTPQPWVIQSSEIHTVQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKI     71 - 140
LNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQISNPGSDGVQGLQAL    141 - 210
TMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDEETELAPSHMAAATGDMPTYQIRAPTAALPQ    211 - 280
GVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELET    281 - 350
LKDICSPKTDY                                                               351 - 361
//

Text Mined References (109)

PMID Year Title
26601115 2015 Cyclic AMP-Responsive Element Modulator ? Polymorphisms Are Potential Genetic Risks for Systemic Lupus Erythematosus.
25401338 2014 Specific genomic and transcriptomic aberrations in tumors induced by partial hepatectomy of a chronically inflamed murine liver.
24943041 2014 CREM variants rs4934540 and rs2295415 conferred susceptibility to nonobstructive azoospermia risk in the Chinese population.
24672804 2014 Decompensation of ?-cells in diabetes: when pancreatic ?-cells are on ICE(R).
24667640 2014 CaMK4-dependent activation of AKT/mTOR and CREM-? underlies autoimmunity-associated Th17 imbalance.
24297179 2014 cAMP responsive element modulator (CREM) ? mediates chromatin remodeling of CD8 during the generation of CD3+ CD4- CD8- T cells.
24100545 2013 Wide distribution of CREM immunoreactivity in adult and fetal human brain, with an increased expression in dentate gyrus neurons of Alzheimer's as compared to normal aging brains.
24047902 2013 cAMP-responsive element modulator ? (CREM?) trans-represses the transmembrane glycoprotein CD8 and contributes to the generation of CD3+CD4-CD8- T cells in health and disease.
23929392 2013 Low expression of cyclic AMP response element modulator-1 can increase the migration and invasion of esophageal squamous cell carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...