Property Summary

NCBI Gene PubMed Count 47
PubMed Score 29.73
PubTator Score 32.92

Knowledge Summary

Patent

No data available

Expression

Gene RIF (38)

AA Sequence

MLLLINVILTLWVSCANGQVKPCDFPDIKHGGLFHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDYI      1 - 70
HCTQNGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGNSTEVACHPGYGLPKAQTTVTCTEKGWSPTPRC     71 - 140
IRVRTCSKSDIEIENGFISESSSIYILNKEIQYKCKPGYATADGNSSGSITCLQNGWSAQPICINSSEKC    141 - 210
GPPPPISNGDTTSFLLKVYVPQSRVEYQCQPYYELQGSNYVTCSNGEWSEPPRCIHPCIITEENMNKNNI    211 - 280
KLKGRSDRKYYAKTGDTIEFMCKLGYNANTSILSFQAVCREGIVEYPRCE                        281 - 330
//

Text Mined References (48)

PMID Year Title