Property Summary

NCBI Gene PubMed Count 39
PubMed Score 91.86
PubTator Score 73.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Prostatic Neoplasms 471
Disease Target Count P-value
ovarian cancer 8492 5.24272266331491E-10
malignant mesothelioma 3163 7.82931304871823E-9
lung cancer 4473 1.03513027372306E-4
chronic lymphocytic leukemia 244 2.4775810719793E-4
cystic fibrosis 1670 2.55305962313298E-4
cutaneous lupus erythematosus 1056 8.70754807355452E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0010397494888646
medulloblastoma 1524 0.00107959346576474
Waldenstrons macroglobulinemia 765 0.00280582141057803
invasive ductal carcinoma 2950 0.00498200398225953
interstitial cystitis 2299 0.0076689604780272
primitive neuroectodermal tumor 3031 0.00867134628842904
osteosarcoma 7933 0.0169677163626917
spina bifida 1064 0.0348653837875015
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0351229420710193
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0365245781307823
subependymal giant cell astrocytoma 2287 0.0386321697537555
Disease Target Count Z-score Confidence
Bipolar Disorder 266 0.0 1.0

Expression

Synonym

Accession Q02742 Q6DJZ4
Symbols G6NT
C2GNT
C2GNT1
NACGT2
NAGCT2
C2GNT-L

Gene

PANTHER Protein Class (2)

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (30)

PMID Text
26768364 GCNT1 expression in prostate biopsy specimen is a significant and independent predictor of recurrence after radical prostatectomy, which can be used in pre-treatment decision making for the patient.
26390303 GCNT1 expression in prostate cancer positively correlates with cancer progression and prostate-specific antigen recurrence.
25086069 Results show that ST3Gal1 uses GM130-GRASP65 and giantin, whereas C2GnT-L uses only giantin for Golgi targeting and defective giantin dimerization in PC-3 and DU145 prostate cancer cells causes fragmentation of the Golgi and prevents its targeting.
24854630 GCNT1 is over-expressed in prostate cancer and is associated with higher levels of core 2 O-sLe(x) in PSA, PAP and MUC1 proteins.
23990450 NMIIA is the master regulator of Golgi fragmentation induced by heat shock or inhibition/depletion of HSP70/90 through interaction with gylosyltransferases.
23617619 Immunohistochemical expression of core 2 beta1,6-N-acetylglucosaminyl transferase 1 (C2GnT1) in endometrioid-type endometrial carcinoma may be a novel potential prognostic factor.
23165940 C2GnT-expressing prostate cancer cells evade NK cell immunity and survive longer in the host blood circulation, thereby resulting in the promotion of prostate cancer metastasis.
23027862 GOLPH3 can regulate cell-cell interaction by controlling Golgi retention of C2GnT1.
22534569 Down-regulation of C2GnT1 is correlated with breast cancer
22056345 The X-ray crystal structure (2.3 A resolution) of a mutant form of C2GnT-L (C217S) in complex with UDP was solved. C2GnT-L exists in an "open" conformation and a "closed" conformation.
More...

AA Sequence

MLRTLLRRRLFSYPTKYYFMVLVLSLITFSVLRIHQKPEFVSVRHLELAGENPSSDINCTKVLQGDVNEI      1 - 70
QKVKLEILTVKFKKRPRWTPDDYINMTSDCSSFIKRRKYIVEPLSKEEAEFPIAYSIVVHHKIEMLDRLL     71 - 140
RAIYMPQNFYCIHVDTKSEDSYLAAVMGIASCFSNVFVASRLESVVYASWSRVQADLNCMKDLYAMSANW    141 - 210
KYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLET    211 - 280
PLFSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWATIQRIPEVPGSLPASHKYDLSDMQAV    281 - 350
ARFVKWQYFEGDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHHLFANKFDVDVDLFAIQCLDEHLRH    351 - 420
KALETLKH                                                                  421 - 428
//

Text Mined References (41)

PMID Year Title
26768364 2016 Core 2 ?-1, 6-N-acetylglucosaminyltransferase-1 expression in prostate biopsy specimen is an indicator of prostate cancer aggressiveness.
26390303 2015 Detection of Core2 ?-1,6-N-Acetylglucosaminyltransferase in Post-Digital Rectal Examination Urine Is a Reliable Indicator for Extracapsular Extension of Prostate Cancer.
25086069 2014 Restoration of compact Golgi morphology in advanced prostate cancer enhances susceptibility to galectin-1-induced apoptosis by modifying mucin O-glycan synthesis.
24854630 2014 Increased expression of GCNT1 is associated with altered O-glycosylation of PSA, PAP, and MUC1 in human prostate cancers.
23990450 2014 Golgi fragmentation induced by heat shock or inhibition of heat shock proteins is mediated by non-muscle myosin IIA via its interaction with glycosyltransferases.
23617619 2013 Immunohistochemical expression of core 2 ?1,6-N-acetylglucosaminyl transferase 1 (C2GnT1) in endometrioid-type endometrial carcinoma: a novel potential prognostic factor.
23165940 2013 Core2 O-glycan-expressing prostate cancer cells are resistant to NK cell immunity.
23027862 2012 Golgi phosphoprotein 3 determines cell binding properties under dynamic flow by controlling Golgi localization of core 2 N-acetylglucosaminyltransferase 1.
22534569 2012 MUC1 in human and murine mammary carcinoma cells decreases the expression of core 2 ?1,6-N-acetylglucosaminyltransferase and ?-galactoside ?2,3-sialyltransferase.
22056345 2011 Structural and mechanistic characterization of leukocyte-type core 2 ?1,6-N-acetylglucosaminyltransferase: a metal-ion-independent GT-A glycosyltransferase.
More...