Property Summary

NCBI Gene PubMed Count 39
Grant Count 30
R01 Count 14
Funding $2,019,571.28
PubMed Score 91.86
PubTator Score 73.90

Knowledge Summary

Patent

No data available

Expression

Gene RIF (30)

PMID Text
26768364 GCNT1 expression in prostate biopsy specimen is a significant and independent predictor of recurrence after radical prostatectomy, which can be used in pre-treatment decision making for the patient.
26390303 GCNT1 expression in prostate cancer positively correlates with cancer progression and prostate-specific antigen recurrence.
25086069 Results show that ST3Gal1 uses GM130-GRASP65 and giantin, whereas C2GnT-L uses only giantin for Golgi targeting and defective giantin dimerization in PC-3 and DU145 prostate cancer cells causes fragmentation of the Golgi and prevents its targeting.
24854630 GCNT1 is over-expressed in prostate cancer and is associated with higher levels of core 2 O-sLe(x) in PSA, PAP and MUC1 proteins.
23990450 NMIIA is the master regulator of Golgi fragmentation induced by heat shock or inhibition/depletion of HSP70/90 through interaction with gylosyltransferases.
23617619 Immunohistochemical expression of core 2 beta1,6-N-acetylglucosaminyl transferase 1 (C2GnT1) in endometrioid-type endometrial carcinoma may be a novel potential prognostic factor.
23165940 C2GnT-expressing prostate cancer cells evade NK cell immunity and survive longer in the host blood circulation, thereby resulting in the promotion of prostate cancer metastasis.
23027862 GOLPH3 can regulate cell-cell interaction by controlling Golgi retention of C2GnT1.
22534569 Down-regulation of C2GnT1 is correlated with breast cancer
22056345 The X-ray crystal structure (2.3 A resolution) of a mutant form of C2GnT-L (C217S) in complex with UDP was solved. C2GnT-L exists in an "open" conformation and a "closed" conformation.
More...

AA Sequence

MLRTLLRRRLFSYPTKYYFMVLVLSLITFSVLRIHQKPEFVSVRHLELAGENPSSDINCTKVLQGDVNEI      1 - 70
QKVKLEILTVKFKKRPRWTPDDYINMTSDCSSFIKRRKYIVEPLSKEEAEFPIAYSIVVHHKIEMLDRLL     71 - 140
RAIYMPQNFYCIHVDTKSEDSYLAAVMGIASCFSNVFVASRLESVVYASWSRVQADLNCMKDLYAMSANW    141 - 210
KYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLET    211 - 280
PLFSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWATIQRIPEVPGSLPASHKYDLSDMQAV    281 - 350
ARFVKWQYFEGDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHHLFANKFDVDVDLFAIQCLDEHLRH    351 - 420
KALETLKH                                                                  421 - 428
//

Text Mined References (41)

PMID Year Title
26768364 2016 Core 2 ?-1, 6-N-acetylglucosaminyltransferase-1 expression in prostate biopsy specimen is an indicator of prostate cancer aggressiveness.
26390303 2015 Detection of Core2 ?-1,6-N-Acetylglucosaminyltransferase in Post-Digital Rectal Examination Urine Is a Reliable Indicator for Extracapsular Extension of Prostate Cancer.
25086069 2014 Restoration of compact Golgi morphology in advanced prostate cancer enhances susceptibility to galectin-1-induced apoptosis by modifying mucin O-glycan synthesis.
24854630 2014 Increased expression of GCNT1 is associated with altered O-glycosylation of PSA, PAP, and MUC1 in human prostate cancers.
23990450 2014 Golgi fragmentation induced by heat shock or inhibition of heat shock proteins is mediated by non-muscle myosin IIA via its interaction with glycosyltransferases.
23617619 2013 Immunohistochemical expression of core 2 ?1,6-N-acetylglucosaminyl transferase 1 (C2GnT1) in endometrioid-type endometrial carcinoma: a novel potential prognostic factor.
23165940 2013 Core2 O-glycan-expressing prostate cancer cells are resistant to NK cell immunity.
23027862 2012 Golgi phosphoprotein 3 determines cell binding properties under dynamic flow by controlling Golgi localization of core 2 N-acetylglucosaminyltransferase 1.
22534569 2012 MUC1 in human and murine mammary carcinoma cells decreases the expression of core 2 ?1,6-N-acetylglucosaminyltransferase and ?-galactoside ?2,3-sialyltransferase.
22056345 2011 Structural and mechanistic characterization of leukocyte-type core 2 ?1,6-N-acetylglucosaminyltransferase: a metal-ion-independent GT-A glycosyltransferase.
More...