Property Summary

NCBI Gene PubMed Count 39
PubMed Score 93.32
PubTator Score 73.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Protein-protein Interaction (4)

Gene RIF (30)

AA Sequence

MLRTLLRRRLFSYPTKYYFMVLVLSLITFSVLRIHQKPEFVSVRHLELAGENPSSDINCTKVLQGDVNEI      1 - 70
QKVKLEILTVKFKKRPRWTPDDYINMTSDCSSFIKRRKYIVEPLSKEEAEFPIAYSIVVHHKIEMLDRLL     71 - 140
RAIYMPQNFYCIHVDTKSEDSYLAAVMGIASCFSNVFVASRLESVVYASWSRVQADLNCMKDLYAMSANW    141 - 210
KYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLET    211 - 280
PLFSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWATIQRIPEVPGSLPASHKYDLSDMQAV    281 - 350
ARFVKWQYFEGDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHHLFANKFDVDVDLFAIQCLDEHLRH    351 - 420
KALETLKH                                                                  421 - 428
//

Text Mined References (41)

PMID Year Title