Property Summary

NCBI Gene PubMed Count 10
PubMed Score 189.72
PubTator Score 125.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.100 1.5e-02
medulloblastoma, large-cell 2.800 7.0e-05
psoriasis -1.300 1.2e-20

Gene RIF (3)

AA Sequence

MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQHLSREERRRRR      1 - 70
RATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV            71 - 133
//

Text Mined References (10)

PMID Year Title