Property Summary

NCBI Gene PubMed Count 9
Grant Count 25
R01 Count 22
Funding $5,931,622.33
PubMed Score 172.70
PubTator Score 125.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
sonic hedgehog group medulloblastoma 3.100 0.000
medulloblastoma, large-cell 2.800 0.000
psoriasis -1.300 0.000

Gene RIF (2)

PMID Text
25243493 This study identified that CGPs was found to significantly correlate with the differential expression and methylation of genes encoding nescient helix-loop-helix 1.
1328219 expression of NSCL-1 and NSCL-2 in the developing central and peripheral nervous system, most likely in developing neurons.

AA Sequence

MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQHLSREERRRRR      1 - 70
RATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV            71 - 133
//

Text Mined References (9)

PMID Year Title
25243493 2014 Correlation between DNA methylation and gene expression in the brains of patients with bipolar disorder and schizophrenia.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12878195 2003 The LIM-only protein LMO4 modulates the transcriptional activity of HEN1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10603358 2000 Regulation of neurogenesis by interactions between HEN1 and neuronal LMO proteins.
1729708 1992 Molecular characterization of NSCL, a gene encoding a helix-loop-helix protein expressed in the developing nervous system.
1528853 1992 HEN1 and HEN2: a subgroup of basic helix-loop-helix genes that are coexpressed in a human neuroblastoma.
1328219 1992 A comparative structural characterization of the human NSCL-1 and NSCL-2 genes. Two basic helix-loop-helix genes expressed in the developing nervous system.