Property Summary

NCBI Gene PubMed Count 70
PubMed Score 79.67
PubTator Score 91.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Arrhythmogenic right ventricular cardiomyopathy 30 6.68 3.3
Disease Target Count Z-score Confidence
Cardiomyopathy 116 0.0 4.0

Expression

  Differential Expression (24)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 8.3e-06
Atopic dermatitis 2.300 4.5e-04
atypical teratoid / rhabdoid tumor 1.100 3.4e-02
Breast cancer -1.700 1.8e-05
Crohn's disease -1.075 3.8e-02
cutaneous lupus erythematosus 2.300 5.4e-03
cystic fibrosis 1.200 1.3e-02
ductal carcinoma in situ 1.100 3.0e-02
ependymoma 1.200 6.1e-05
group 4 medulloblastoma 1.700 5.5e-04
intraductal papillary-mucinous adenoma (... 2.300 4.6e-04
intraductal papillary-mucinous carcinoma... 2.000 5.2e-03
intraductal papillary-mucinous neoplasm ... 2.000 1.4e-02
lung cancer 2.900 4.0e-05
lung carcinoma -2.900 6.7e-34
malignant mesothelioma 1.400 2.5e-05
mucosa-associated lymphoid tissue lympho... 2.320 4.2e-02
non-small cell lung cancer 1.592 2.8e-08
ovarian cancer 2.500 4.3e-05
periodontitis -1.200 1.9e-17
psoriasis 1.800 5.2e-07
Rheumatoid arthritis 2.300 5.5e-04
spina bifida -2.402 2.4e-02
ulcerative colitis -1.171 1.5e-02

 CSPA Cell Line (4)

Gene RIF (40)

AA Sequence

MEAARPSGSWNGALCRLLLLTLAILIFASDACKNVTLHVPSKLDAEKLVGRVNLKECFTAANLIHSSDPD      1 - 70
FQILEDGSVYTTNTILLSSEKRSFTILLSNTENQEKKKIFVFLEHQTKVLKKRHTKEKVLRRAKRRWAPI     71 - 140
PCSMLENSLGPFPLFLQQVQSDTAQNYTIYYSIRGPGVDQEPRNLFYVERDTGNLYCTRPVDREQYESFE    141 - 210
IIAFATTPDGYTPELPLPLIIKIEDENDNYPIFTEETYTFTIFENCRVGTTVGQVCATDKDEPDTMHTRL    211 - 280
KYSIIGQVPPSPTLFSMHPTTGVITTTSSQLDRELIDKYQLKIKVQDMDGQYFGLQTTSTCIINIDDVND    281 - 350
HLPTFTRTSYVTSVEENTVDVEILRVTVEDKDLVNTANWRANYTILKGNENGNFKIVTDAKTNEGVLCVV    351 - 420
KPLNYEEKQQMILQIGVVNEAPFSREASPRSAMSTATVTVNVEDQDEGPECNPPIQTVRMKENAEVGTTS    421 - 490
NGYKAYDPETRSSSGIRYKKLTDPTGWVTIDENTGSIKVFRSLDREAETIKNGIYNITVLASDQGGRTCT    491 - 560
GTLGIILQDVNDNSPFIPKKTVIICKPTMSSAEIVAVDPDEPIHGPPFDFSLESSTSEVQRMWRLKAIND    561 - 630
TAARLSYQNDPPFGSYVVPITVRDRLGMSSVTSLDVTLCDCITENDCTHRVDPRIGGGGVQLGKWAILAI    631 - 700
LLGIALLFCILFTLVCGASGTSKQPKVIPDDLAQQNLIVSNTEAPGDDKVYSANGFTTQTVGASAQGVCG    701 - 770
TVGSGIKNGGQETIEMVKGGHQTSESCRGAGHHHTLDSCRGGHTEVDNCRYTYSEWHSFTQPRLGEKVYL    771 - 840
CNQDENHKHAQDYVLTYNYEGRGSVAGSVGCCSERQEEDGLEFLDNLEPKFRTLAEACMKR             841 - 901
//

Text Mined References (71)

PMID Year Title