Property Summary

NCBI Gene PubMed Count 9
Grant Count 5
R01 Count 5
Funding $416,216.66
PubMed Score 20.79
PubTator Score 15.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
gastric cancer 1.500 0.008
osteosarcoma -2.357 0.000
ependymoma -1.300 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
glioblastoma -2.000 0.000
medulloblastoma, large-cell -1.600 0.007
pancreatic ductal adenocarcinoma liver m... -2.369 0.008
pediatric high grade glioma -1.400 0.001
pilocytic astrocytoma -1.300 0.001
Pick disease -1.200 0.000
ovarian cancer -1.300 0.000

Gene RIF (2)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGPSLFSVTKKQLGAGSREECAAKCEEDKEFTCRAFQYHSKE      1 - 70
QQCVIMAENRKSSIIIRMRDAVLFEK                                                 71 - 96
//

Text Mined References (9)

PMID Year Title
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
2714803 1989 A gene homologous to plasminogen located on human chromosome 2q11-p11.
1986355 1991 Two types of abnormal genes for plasminogen in families with a predisposition for thrombosis.
1554698 1992 Multiple members of the plasminogen-apolipoprotein(a) gene family associated with thrombosis.
1379800 1992 A plasminogen-related gene is expressed in cancer cells.