Property Summary

NCBI Gene PubMed Count 120
PubMed Score 337.58
PubTator Score 281.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy 1.020 5.7e-05
adult high grade glioma -1.200 2.2e-03
atypical teratoid / rhabdoid tumor -2.200 3.3e-06
Breast cancer 2.100 4.0e-02
ependymoma -1.200 3.6e-09
glioblastoma -1.100 6.5e-05
group 3 medulloblastoma -1.100 6.8e-03
intraductal papillary-mucinous carcinoma... 1.100 4.3e-02
lung cancer -1.400 3.9e-03
medulloblastoma, large-cell -2.700 2.0e-06
Multiple myeloma 1.753 8.8e-04
oligodendroglioma -1.100 1.6e-15
ovarian cancer -1.800 1.9e-08
primitive neuroectodermal tumor -1.300 9.0e-04
Rheumatoid arthritis 3.300 4.5e-04
subependymal giant cell astrocytoma 1.177 3.4e-02

Protein-protein Interaction (1)

Gene RIF (88)

AA Sequence

MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYT      1 - 70
EYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINEEFDNMMRNHKIAPGLPPQNF     71 - 140
SMSVTVPVTSPNALSYTNPGSSLVSPSLAASSTLTDSSMLSPPQTTLHRNVSPGAPQRPPSTGNAGGMLS    141 - 210
TTDLTVPNGAGSSPVGNGFVNSRASPNLIGATGANSLGKVMPTKSPPPPGGGNLGMNSRKPDLRVVIPPS    211 - 280
SKGMMPPLSEEEELELNTQRISSSQATQPLATPVVSVTTPSLPPQGLVYSAMPTAYNTDYSLTSADLSAL    281 - 350
QGFNSPGMLSLGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNISIKSEPISPPRDRMTPSGFQ    351 - 420
QQQQQQQQQQPPPPPQPQPQPPQPQPRQEMGRSPVDSLSSSSSSYDGSDREDPRGDFHSPIVLGRPPNTE    421 - 490
DRESPSVKRMRMDAWVT                                                         491 - 507
//

Text Mined References (131)

PMID Year Title