Property Summary

NCBI Gene PubMed Count 118
Grant Count 76
R01 Count 44
Funding $10,977,309.52
PubMed Score 315.43
PubTator Score 281.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Rheumatoid Arthritis 3.300 0.000
Multiple myeloma 1.753 0.001
oligodendroglioma -1.100 0.000
ependymoma -1.200 0.000
glioblastoma -1.600 0.001
medulloblastoma -1.500 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma, large-cell -2.700 0.000
primitive neuroectodermal tumor -1.300 0.001
acute quadriplegic myopathy 1.020 0.000
intraductal papillary-mucinous carcinoma... 1.100 0.043
lung cancer -1.600 0.000
Breast cancer 2.100 0.040
pediatric high grade glioma -1.200 0.000
subependymal giant cell astrocytoma 1.177 0.034
ovarian cancer -1.800 0.000

Synonym

Accession Q02078 B4DFQ7 F6XG23 O43814 Q14223 Q14224 Q59GX4 Q7Z6C9 Q96D14
Symbols mef2
ADCAD1
RSRFC4
RSRFC9

Gene

PDB

3P57   1C7U   1EGW   1LEW   3KOV   3MU6  

Gene RIF (87)

PMID Text
26552705 p38 MAPK is a key regulator of canonical Wnt signaling by promoting a phospho-dependent interaction between MEF2 and beta-catenin to enhance cooperative transcriptional activity and cell proliferation.
26421691 The findings of this study are consistent with MEF2A deregulation conferring risk of formal thought disorder.
26400337 Variants in the 3'-UTR of MEF2A are associated with coronary artery disease in a Chinese Han population.
25809782 Mechanistically, MEF-2 was recruited to the viral promoter (LTR, long terminal repeat) in the context of chromatin, and constituted Tax/CREB transcriptional complex via direct binding to the HTLV-1 LTR.
25655189 Our results revealed a link and interaction between MEF2A and miR-143 and suggested a potential mechanism for MEF2A to regulate H(2)O(2) -induced VSMC senescence.
25366733 six or seven amino acid deletions and synonymous mutations (147143G-->A)in exon 11 of the MEF2A gene may be correlated with susceptibility to coronary artery disease in the Chinese population
25336633 MEF2 is the key cis-acting factor that regulates expression of a number of transcriptional targets involved in pulmonary vascular homeostasis, including microRNAs 424 and 503, connexins 37, and 40, and Kruppel Like Factors 2 and 4.
25087096 MEF2 transcription factors promotes epithelial-mesenchymal transition and invasiveness of hepatocellular carcinoma through TGF-beta1 autoregulation circuitry.
24879151 MEF2A is targeted to lysosomes for chaperone-mediated autophagy degradation; oxidative stress-induced lysosome destabilization leads to the disruption of MEF2A degradation as well as the dysregulation of its function
24043307 Correlation studies depicted two distinct groups of soft tissue sarcomas: one in which MEF2 repression correlates with PTEN downregulation and a second group in which MEF2 repression correlates with HDAC4 levels.
More...

AA Sequence

MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYT      1 - 70
EYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINEEFDNMMRNHKIAPGLPPQNF     71 - 140
SMSVTVPVTSPNALSYTNPGSSLVSPSLAASSTLTDSSMLSPPQTTLHRNVSPGAPQRPPSTGNAGGMLS    141 - 210
TTDLTVPNGAGSSPVGNGFVNSRASPNLIGATGANSLGKVMPTKSPPPPGGGNLGMNSRKPDLRVVIPPS    211 - 280
SKGMMPPLSEEEELELNTQRISSSQATQPLATPVVSVTTPSLPPQGLVYSAMPTAYNTDYSLTSADLSAL    281 - 350
QGFNSPGMLSLGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNISIKSEPISPPRDRMTPSGFQ    351 - 420
QQQQQQQQQQPPPPPQPQPQPPQPQPRQEMGRSPVDSLSSSSSSYDGSDREDPRGDFHSPIVLGRPPNTE    421 - 490
DRESPSVKRMRMDAWVT                                                         491 - 507
//

Text Mined References (129)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26552705 2015 A p38 Mitogen-Activated Protein Kinase-Regulated Myocyte Enhancer Factor 2-?-Catenin Interaction Enhances Canonical Wnt Signaling.
26421691 2015 Linkage and whole genome sequencing identify a locus on 6q25-26 for formal thought disorder and implicate MEF2A regulation.
26400337 2015 Association of MEF2A gene 3'UTR mutations with coronary artery disease.
25809782 2015 Myocyte enhancer factor (MEF)-2 plays essential roles in T-cell transformation associated with HTLV-1 infection by stabilizing complex between Tax and CREB.
25655189 2015 Myocyte Enhancer Factor 2A Regulates Hydrogen Peroxide-Induced Senescence of Vascular Smooth Muscle Cells Via microRNA-143.
25366733 2014 MEF2A gene mutations and susceptibility to coronary artery disease in the Chinese population.
25336633 2015 Restoration of impaired endothelial myocyte enhancer factor 2 function rescues pulmonary arterial hypertension.
25087096 2014 MEF2 transcription factors promotes EMT and invasiveness of hepatocellular carcinoma through TGF-?1 autoregulation circuitry.
24879151 2014 Disruption of chaperone-mediated autophagy-dependent degradation of MEF2A by oxidative stress-induced lysosome destabilization.
More...