Property Summary

NCBI Gene PubMed Count 13
PubMed Score 63.10
PubTator Score 8.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
oligodendroglioma 1.200 0.011
psoriasis 1.100 0.018
ovarian cancer -2.300 0.000

Synonym

Accession Q02040 Q02832 Q2TB98 Q5JQ74 Q5JQ76 Q8N6U9 AKAP-17A
Symbols XE7
721P
XE7Y
CCDC133
CXYorf3
PRKA17A
SFRS17A
AKAP-17A
DXYS155E

Gene

  Ortholog (9)

Species Source
Macaque OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
C. elegans EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Pathway (1)

Gene RIF (1)

PMID Text
16982639 The spliceosomal component XE7 resembles an SR-related splicing protein, and can influence alternative splicing.

AA Sequence

MAAATIVHDTSEAVELCPAYGLYLKPITKMTISVALPQLKQPGKSISNWEVMERLKGMVQNHQFSTLRIS      1 - 70
KSTMDFIRFEGEVENKSLVKSFLACLDGKTIKLSGFSDILKVRAAEFKIDFPTRHDWDSFFRDAKDMNET     71 - 140
LPGERPDTIHLEGLPCKWFALKESGSEKPSEDVLVKVFEKFGEIRNVDIPMLDPYREEMTGRNFHTFSFG    141 - 210
GHLNFEAYVQYREYMGFIQAMSALRGMKLMYKGEDGKAVACNIKVSFDSTKHLSDASIKKRQLERQKLQE    211 - 280
LEQQREEQKRREKEAEERQRAEERKQKELEELERERKREEKLRKREQKQRDRELRRNQKKLEKLQAEEQK    281 - 350
QLQEKIKLEERKLLLAQRNLQSIRLIAELLSRAKAVKLREQEQKEEKLRLQQQEERRRLQEAELRRVEEE    351 - 420
KERALGLQRKERELRERLLSILLSKKPDDSHTHDELGVAHADLLQPVLDILQTVSSGCVSATTLHPLGGQ    421 - 490
PPAGAPKESPAHPEADGAPKSVNGSVAEEAPCKEVQSSCRVVPEDGSPEKRCPGGVLSCIPDNNQQPKGI    491 - 560
PACEQNVSRKDTRSEQDKCNREPSKGRGRATGDGLADRHKRERSRARRASSREDGRPRKERRPHKKHAYK    561 - 630
DDSPRRRSTSPDHTRSRRSHSKDRHRRERSRERRGSASRKHSRHRRRSERSRSRSPSRHRSTWNR         631 - 695
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19840947 2009 Splicing factor arginine/serine-rich 17A (SFRS17A) is an A-kinase anchoring protein that targets protein kinase A to splicing factor compartments.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
More...