Property Summary

NCBI Gene PubMed Count 25
Grant Count 52
R01 Count 28
Funding $8,075,095.34
PubMed Score 277.26
PubTator Score 23.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Gene RIF (4)

PMID Text
26821013 Study shows that BNC1 expression was down-regulated in hepatocellular tumors and cell lines through its promotor hypermethylation.
24662832 Study demonstrates that Bnc1 regulates epithelial plasticity of mammary epithelial cells and influences outcome of TGF-beta1 signaling.
21741828 p63 induces the expression of the basal epithelial transcription factor, Basonuclin 1.
16891417 Data show that basonuclin (Bn)2 but not bn1 colocalizes with SC35 in nuclear speckles, and may have a function in nuclear processing of mRNA.

AA Sequence

MRRRPPSRGGRGAARARETRRQPRHRSGRRMAEAISCTLNCSCQSFKPGKINHRQCDQCKHGWVAHALSK      1 - 70
LRIPPMYPTSQVEIVQSNVVFDISSLMLYGTQAIPVRLKILLDRLFSVLKQDEVLQILHALDWTLQDYIR     71 - 140
GYVLQDASGKVLDHWSIMTSEEEVATLQQFLRFGETKSIVELMAIQEKEEQSIIIPPSTANVDIRAFIES    141 - 210
CSHRSSSLPTPVDKGNPSSIHPFENLISNMTFMLPFQFFNPLPPALIGSLPEQYMLEQGHDQSQDPKQEV    211 - 280
HGPFPDSSFLTSSSTPFQVEKDQCLNCPDAITKKEDSTHLSDSSSYNIVTKFERTQLSPEAKVKPERNSL    281 - 350
GTKKGRVFCTACEKTFYDKGTLKIHYNAVHLKIKHKCTIEGCNMVFSSLRSRNRHSANPNPRLHMPMNRN    351 - 420
NRDKDLRNSLNLASSENYKCPGFTVTSPDCRPPPSYPGSGEDSKGQPAFPNIGQNGVLFPNLKTVQPVLP    421 - 490
FYRSPATPAEVANTPGILPSLPLLSSSIPEQLISNEMPFDALPKKKSRKSSMPIKIEKEAVEIANEKRHN    491 - 560
LSSDEDMPLQVVSEDEQEACSPQSHRVSEEQHVQSGGLGKPFPEGERPCHRESVIESSGAISQTPEQATH    561 - 630
NSERETEQTPALIMVPREVEDGGHEHYFTPGMEPQVPFSDYMELQQRLLAGGLFSALSNRGMAFPCLEDS    631 - 700
KELEHVGQHALARQIEENRFQCDICKKTFKNACSVKIHHKNMHVKEMHTCTVEGCNATFPSRRSRDRHSS    701 - 770
NLNLHQKALSQEALESSEDHFRAAYLLKDVAKEAYQDVAFTQQASQTSVIFKGTSRMGSLVYPITQVHSA    771 - 840
SLESYNSGPLSEGTILDLSTTSSMKSESSSHSSWDSDGVSEEGTVLMEDSDGNCEGSSLVPGEDEYPICV    841 - 910
LMEKADQSLASLPSGLPITCHLCQKTYSNKGTFRAHYKTVHLRQLHKCKVPGCNTMFSSVRSRNRHSQNP    911 - 980
NLHKSLASSPSHLQ                                                            981 - 994
//

Text Mined References (25)

PMID Year Title
26821013 2016 Decreased Expression of BNC1 and BNC2 Is Associated with Genetic or Epigenetic Regulation in Hepatocellular Carcinoma.
24662832 2015 Basonuclin-1 modulates epithelial plasticity and TGF-?1-induced loss of epithelial cell integrity.
24454902 2014 Tumor-specific hypermethylation of epigenetic biomarkers, including SFRP1, predicts for poorer survival in patients from the TCGA Kidney Renal Clear Cell Carcinoma (KIRC) project.
24088737 2013 Novel methylation biomarker panel for the early detection of pancreatic cancer.
23707421 2013 HSF2BP represses BNC1 transcriptional activity by sequestering BNC1 to the cytoplasm.
21741828 2012 p63 Transcriptionally regulates BNC1, a Pol I and Pol II transcription factor that regulates ribosomal biogenesis and epithelial differentiation.
20531302 2010 Global analysis of CpG methylation reveals epigenetic control of the radiosensitivity in lung cancer cell lines.
20484983 2010 Genome-wide DNA methylation profiling of chronic lymphocytic leukemia allows identification of epigenetically repressed molecular pathways with clinical impact.
20154727 2010 Identification of candidate tumour suppressor genes frequently methylated in renal cell carcinoma.
19430199 2009 Epigenetic analysis of childhood acute lymphoblastic leukemia.
More...