Property Summary

NCBI Gene PubMed Count 436
Grant Count 465
R01 Count 187
Funding $51,857,109.15
PubMed Score 1980.81
PubTator Score 1751.19

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q01860 A6NCS1 A6NLL8 D2IYK4 P31359 Q15167 Q15168 Q16422 Q5STF3 Q5STF4
Symbols OCT3
OCT4
OTF3
OTF4
OTF-3
Oct-3
Oct-4

Gene

Gene RIF (384)

PMID Text
27067776 Higher OCT4 expression represents a clinically relevant predictor of patient prognosis in prostate cancer
26996130 Oct4 plays a pivotal role in the maintenance of lung CSCs resistant to gefitinib in EGFR mutation-positive non-small cell lung cancer
26992828 Sox2 and Oct4 function as molecular rheostats and utilize negative feedback loops to carefully balance their expression and other critical genes during embryogenesis. (Review)
26940070 The promoter activity of Nanog and Oct4 were upregulated, and beta-catenin was observed to bind to these promoters during H. pylori infection, while a Wnt/beta-catenin inhibitor suppressed promoter activity and binding.
26927547 Data show that octamer-binding protein-4 (Oct4) cDNA was cloned and its protein was successfully expressed in E.coli and HEK293T cells.
26824036 These findings indicate that potentially functional polymorphisms in POU5F1 gene may contribute to lung cancer susceptibility in a Chinese population.
26769970 The level of Oct4 repression was dependent on the level of GCNF expression in a dose-dependent manner.
26706028 OCT4 overexpression and loss of SOX2 expression are strongly associated with poor prognosis in patients with cervical cancer.
26654770 Several novel and known AKT phosphorylation sites are identified within OCT4, SOX2 and KLF4.
26639784 GLUT3 and OCT4 expression were correlated suggesting that Human embryonic stem cells self-renewal is regulated by the rate of glucose uptake.
More...

AA Sequence

MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFC      1 - 70
GGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIK     71 - 140
ALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEE    141 - 210
ADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCN    211 - 280
RRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSV    281 - 350
TTLGSPMHSN                                                                351 - 360
//

Text Mined References (440)

PMID Year Title
27067776 2016 The prognostic significance of OCT4 expression in patients with prostate cancer.
26996130 2016 Oct4 plays a crucial role in the maintenance of gefitinib-resistant lung cancer stem cells.
26992828 2016 Sox2/Oct4: A delicately balanced partnership in pluripotent stem cells and embryogenesis.
26940070 2016 Helicobacter pylori upregulates Nanog and Oct4 via Wnt/?-catenin signaling pathway to promote cancer stem cell-like properties in human gastric cancer.
26927547 2016 [Cloning and expression of human octamer-binding protein-4 (Oct4) cDNA in Escherichia coli and HEK293T cells].
26824036 2015 Potentially Functional Polymorphisms in POU5F1 Gene Are Associated with the Risk of Lung Cancer in Han Chinese.
26769970 2016 Germ Cell Nuclear Factor (GCNF) Represses Oct4 Expression and Globally Modulates Gene Expression in Human Embryonic Stem (hES) Cells.
26706028 2015 Clinical significance of OCT4 and SOX2 protein expression in cervical cancer.
26687479 2015 The variant Polycomb Repressor Complex 1 component PCGF1 interacts with a pluripotency sub-network that includes DPPA4, a regulator of embryogenesis.
26654770 2015 Novel AKT phosphorylation sites identified in the pluripotency factors OCT4, SOX2 and KLF4.
More...