Property Summary

NCBI Gene PubMed Count 496
PubMed Score 2140.39
PubTator Score 1751.19

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (2)

Gene RIF (443)

AA Sequence

MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFC      1 - 70
GGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIK     71 - 140
ALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEE    141 - 210
ADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCN    211 - 280
RRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSV    281 - 350
TTLGSPMHSN                                                                351 - 360
//

Text Mined References (500)

PMID Year Title