Property Summary

NCBI Gene PubMed Count 22
Grant Count 60
R01 Count 43
Funding $6,326,428.22
PubMed Score 431.34
PubTator Score 213.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.362 0.002
astrocytic glioma -2.100 0.003
ependymoma -2.200 0.007
oligodendroglioma -2.000 0.005
esophageal adenocarcinoma 1.300 0.033
medulloblastoma -1.200 0.000
invasive ductal carcinoma 1.100 0.000
ovarian cancer 2.000 0.000

Synonym

Accession Q01850 A8K8A8 Q13977
Symbols Yo
CDR62

Gene

Gene RIF (10)

PMID Text
23531419 Onconeuronal antigen Cdr2 correlates with HIF prolyl-4-hydroxylase PHD1 and worse prognosis in renal cell carcinoma.
22351748 This study shows a very high frequency of HER2 overexpression in breast cancers in patients with anti-Yo-associated paraneoplastic cerebellar degeneration.
21080165 The results suggest that Yo antibodies are not only related to the expression of CDR2 alone, but also to immune dysregulation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19680650 The association between Yo and CCDC104 antibodies in paraneoplastic neurological syndromes may indicate functional similarities.
19581925 Cdr2 protein strongly accumulates in papillary renal cell carcinoma, attenuates the HIF response to tumor hypoxia and may become of diagnostic importance as novel renal tumor marker.
16054780 Mycoplasma fermentans, in infecting human B cells, generates a Mycoplasma component that interacts with CD21, which is involved in B cell proliferation.
15081253 In patients with paraneoplastic cerebellar degeneration and anti-Yo antibodies, IFN-gamma-secreting cell responses towards Cdr2 isoforms are not detected, suggesting a limited role for cytotoxic T lymphocyte-mediated tumor immunity in this patient group.
10465786 Identifies c-Myc interaction with cdr2 by co-IP and co-localization in cytoplasm of cerebellar Purkinje neurons. Sera from 6/6 patients with cdr2 autoantibodies and paraneoplastic cerebellar degeneration block this interaction.
9809559 Identifies cdr2-specific T cells in patients with paraneoplastic cerebellar degeneration; cells are evident by standard CTL, and by cross-presentation of apoptotic cdr2-expressing cells.

AA Sequence

MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQQMYTTNQEQLQEIEYLTKQV      1 - 70
ELLRQMNEQHAKVYEQLDVTARELEETNQKLVADSKASQQKILSLTETIECLQTNIDHLQSQVEELKSSG     71 - 140
QGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKKTVTMLQAQLS    141 - 210
LERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLY    211 - 280
VPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVD    281 - 350
TQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPP    351 - 420
EYKALFKEIFSCIKKTKQEIDEQRTKYRSLSSHS                                        421 - 454
//

Text Mined References (28)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23531419 2013 Onconeuronal antigen Cdr2 correlates with HIF prolyl-4-hydroxylase PHD1 and worse prognosis in renal cell carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22351748 2012 Human epidermal growth factor receptor 2 overexpression in breast cancer of patients with anti-Yo--associated paraneoplastic cerebellar degeneration.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21080165 2011 CDR2 antigen and Yo antibodies.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...