Property Summary

NCBI Gene PubMed Count 25
PubMed Score 450.31
PubTator Score 213.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -2.100 2.8e-03
ependymoma -2.200 7.5e-03
esophageal adenocarcinoma 1.300 3.3e-02
group 4 medulloblastoma -1.200 3.8e-04
invasive ductal carcinoma 1.100 3.3e-04
Multiple myeloma 1.362 2.3e-03
oligodendroglioma -2.000 4.6e-03
ovarian cancer 2.000 8.5e-05

Synonym

Accession Q01850 A8K8A8 Q13977
Symbols Yo
CDR62

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (12)

AA Sequence

MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQQMYTTNQEQLQEIEYLTKQV      1 - 70
ELLRQMNEQHAKVYEQLDVTARELEETNQKLVADSKASQQKILSLTETIECLQTNIDHLQSQVEELKSSG     71 - 140
QGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKKTVTMLQAQLS    141 - 210
LERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLY    211 - 280
VPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVD    281 - 350
TQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPP    351 - 420
EYKALFKEIFSCIKKTKQEIDEQRTKYRSLSSHS                                        421 - 454
//

Text Mined References (31)

PMID Year Title