Property Summary

NCBI Gene PubMed Count 119
Grant Count 101
R01 Count 55
Funding $17,765,767.19
PubMed Score 197.91
PubTator Score 185.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Synonym

Accession Q01826 B3KXF1 C9JTR6 Q59EQ0
Symbols

Gene

PDB

1YSE   2L1P   2MW8   2O49   2O4A   3NZL   3TUO  

Gene RIF (99)

PMID Text
26876172 Tumor-driven, unremitting expression of Satb1 in activated Zbtb46+ inflammatory dendritic cells that infiltrate ovarian tumors results in an immunosuppressive phenotype characterized by increased secretion of tumor-promoting Galectin-1 and IL-6.
26701851 High expression of SATB1 is associated with colorectal cancer.
26528635 radiation decreases SATB1 expression and sensitizes cancer cells to confer clinical benefit of patients, suggesting that SATB1 is predictive of response to preoperative RT and clinical outcome in rectal cancer.
26512778 Findings indicate that high Ki67 antigen/ SATB1 protein ratio was an independent predictor of worse overall survival (OS), while Ki67 and SATB1 did not reach statistical significance as single predictors.
26422397 SATB1 as a Dual Regulator of Anti-Apoptotic BCL2 and Pro-Apoptotic NOXA Genes
26165840 SATB1 reprograms the expression of tumor growth- and metastasis-associated genes to promote tumorigenesis and functionally overlaps with Wnt signaling critical for colorectal cancer tumorigenesis.
26108419 SATB1 is overexpressed in pancreatic cancer, promoting cancer cell proliferation and invasion through the activation of MYC.
26084613 replicative oncolytic adenovirus armed with SATB1 shRNA exhibits effective antitumor effect in human prostate cancer. Our study provides the basis for the development of ZD55-SATB1 for the treatment of prostate cancer
25966097 SATB1 protein expression showed an increasing trend in advancing stages of breast cancer development.
25956130 SATB1 and HER2 expression correlated with poorly differentiated breast cancer and indicated an unfavorable prognosis.
More...

AA Sequence

MDHLNEATQGKEHSEMSNNVSDPKGPPAKIARLEQNGSPLGRGRLGSTGAKMQGVPLKHSGHLMKTNLRK      1 - 70
GTMLPVFCVVEHYENAIEYDCKEEHAEFVLVRKDMLFNQLIEMALLSLGYSHSSAAQAKGLIQVGKWNPV     71 - 140
PLSYVTDAPDATVADMLQDVYHVVTLKIQLHSCPKLEDLPPEQWSHTTVRNALKDLLKDMNQSSLAKECP    141 - 210
LSQSMISSIVNSTYYANVSAAKCQEFGRWYKHFKKTKDMMVEMDSLSELSQQGANHVNFGQQPVPGNTAE    211 - 280
QPPSPAQLSHGSQPSVRTPLPNLHPGLVSTPISPQLVNQQLVMAQLLNQQYAVNRLLAQQSLNQQYLNHP    281 - 350
PPVSRSMNKPLEQQVSTNTEVSSEIYQWVRDELKRAGISQAVFARVAFNRTQGLLSEILRKEEDPKTASQ    351 - 420
SLLVNLRAMQNFLQLPEAERDRIYQDERERSLNAASAMGPAPLISTPPSRPPQVKTATIATERNGKPENN    421 - 490
TMNINASIYDEIQQEMKRAKVSQALFAKVAATKSQGWLCELLRWKEDPSPENRTLWENLSMIRRFLSLPQ    491 - 560
PERDAIYEQESNAVHHHGDRPPHIIHVPAEQIQQQQQQQQQQQQQQQAPPPPQPQQQPQTGPRLPPRQPT    561 - 630
VASPAESDEENRQKTRPRTKISVEALGILQSFIQDVGLYPDEEAIQTLSAQLDLPKYTIIKFFQNQRYYL    631 - 700
KHHGKLKDNSGLEVDVAEYKEEELLKDLEESVQDKNTNTLFSVKLEEELSVEGNTDINTDLKD           701 - 763
//

Text Mined References (130)

PMID Year Title
26876172 2016 Satb1 Overexpression Drives Tumor-Promoting Activities in Cancer-Associated Dendritic Cells.
26701851 2016 SATB1 and SATB2 play opposing roles in c-Myc expression and progression of colorectal cancer.
26528635 2015 Special AT-rich sequence binding protein 1 expression correlates with response to preoperative radiotherapy and clinical outcome in rectal cancer.
26512778 2015 Ki67/SATB1 ratio is an independent prognostic factor of overall survival in patients with early hormone receptor-positive invasive ductal breast carcinoma.
26422397 2015 SATB1 Mediates Long-Range Chromatin Interactions: A Dual Regulator of Anti-Apoptotic BCL2 and Pro-Apoptotic NOXA Genes.
26165840 2016 Wnt/?-catenin signaling regulated SATB1 promotes colorectal cancer tumorigenesis and progression.
26108419 2015 SATB1 Promotes Pancreatic Cancer Growth and Invasion Depending on MYC Activation.
26084613 2015 Oncolytic virus carrying shRNA targeting SATB1 inhibits prostate cancer growth and metastasis.
25966097 2015 Expression and significance of SATB1 in the development of breast cancer.
25956130 2015 Expression of SATB1 and HER2 in breast cancer and the correlations with clinicopathologic characteristics.
More...