Property Summary

NCBI Gene PubMed Count 89
PubMed Score 73.59
PubTator Score 68.33

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma 1.300 3.0e-03
ependymoma 1.700 1.7e-03
oligodendroglioma 1.600 2.8e-03
ovarian cancer -2.600 2.1e-18
pituitary cancer -1.800 1.1e-06
tuberculosis and treatment for 6 months 1.200 2.4e-05

Protein-protein Interaction (9)

Gene RIF (41)

AA Sequence

MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQSADGLRCAVS      1 - 70
DVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRREEDAEKAVIDLNNRWFNGQPI     71 - 140
HAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRELRRELYGRRRKKHRSRSRSRERRSRSRDRG    141 - 210
RGGGGGGGGGGGGRERDRRRSRDRERSGRF                                            211 - 240
//

Text Mined References (97)

PMID Year Title