Property Summary

NCBI Gene PubMed Count 79
Grant Count 41
R01 Count 17
Funding $9,395,236.61
PubMed Score 64.12
PubTator Score 68.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma 1.300 0.003
ependymoma 1.700 0.002
oligodendroglioma 1.600 0.003
tuberculosis and treatment for 6 months 1.300 0.000
ovarian cancer -2.600 0.000
pituitary cancer -1.800 0.000

Gene RIF (31)

PMID Text
25964599 The mutational status of the SRSF2, U2AF1 and ZRSR2 did not affect the response rate or survival in MDS patients who had received first-line decitabine treatment.
25412851 In multivariate analysis, U2AF1 and TP53 mutations retained independent prognostic significance across 93 cases of acute myeloid leukemia
25326705 U2AF has the capacity to directly define ~88% of functional 3' splice sites in the human genome; numerous U2AF binding events also occur in intronic locations.
25311244 The S34F mutation alters U2AF1 function in the context of specific RNA sequences, leading to aberrant alternative splicing of target genes, some of which may be relevant for myelodysplastic syndromes pathogenesis.
25271374 A mutant U2AF1 (S34F) found in a variety of cancer types results in delayed splicing and disruption of kinetic competition during transcription.
25267526 mutations influence the similarity of splicing programs in leukemias, but do not give rise to widespread splicing failure.
25231745 Molecular monitoring of patients having undergone AHSCT for PMF should not be restricted to JAK2, MPL or CALR, but all mutations present in primary fibrotic neoplastic myeloproliferation should be included to interpret abnormal blood values after AHSCT
24498085 Data indicate somatic mutations in the splicing factor U2AF1 across 12 cancer types.
24097336 study describes incidence and phenotypic and prognostic relevance of U2AF1 mutations in primary myelofibrosis(PMF); U2AF1 mutations cluster with JAK2V617F, ASXL1 mutations and normal karyotype; U2AF1 mutations are strongly and inter-independently associated with anemia and thrombocytopenia
23861105 genetic association studies in a population in Taiwan: Data suggest that U2AF1 mutations are associated with poor prognosis/survival in patients with myelodysplastic syndrome and shorter time-to-leukemia transformation in young patients.
More...

AA Sequence

MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQSADGLRCAVS      1 - 70
DVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRREEDAEKAVIDLNNRWFNGQPI     71 - 140
HAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRELRRELYGRRRKKHRSRSRSRERRSRSRDRG    141 - 210
RGGGGGGGGGGGGRERDRRRSRDRERSGRF                                            211 - 240
//

Text Mined References (87)

PMID Year Title
25964599 2015 Mutations in the Spliceosomal Machinery Genes SRSF2, U2AF1, and ZRSR2 and Response to Decitabine in Myelodysplastic Syndrome.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25412851 2015 Next-generation sequencing of acute myeloid leukemia identifies the significance of TP53, U2AF1, ASXL1, and TET2 mutations.
25343990 2015 Genome-wide association study of selenium concentrations.
25326705 2014 Mechanisms for U2AF to define 3' splice sites and regulate alternative splicing in the human genome.
25311244 2015 U2AF1 mutations alter sequence specificity of pre-mRNA binding and splicing.
25271374 2014 Kinetic competition during the transcription cycle results in stochastic RNA processing.
25267526 2015 U2AF1 mutations alter splice site recognition in hematological malignancies.
25231745 2015 SRSF2 and U2AF1 mutations in primary myelofibrosis are associated with JAK2 and MPL but not calreticulin mutation and may independently reoccur after allogeneic stem cell transplantation.
More...