Property Summary

NCBI Gene PubMed Count 17
PubMed Score 37.88
PubTator Score 16.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 3.900 0.000
osteosarcoma 1.578 0.000
cystic fibrosis 1.885 0.000
atypical teratoid / rhabdoid tumor 1.200 0.003
glioblastoma 1.200 0.006
medulloblastoma, large-cell 1.700 0.000
adult high grade glioma 1.400 0.001
Breast cancer -1.200 0.022
ovarian cancer 1.300 0.000
psoriasis 1.300 0.000

Gene RIF (1)

PMID Text
15982419 PSG9 may have a role in development of colorectal carcinogenesis in patients with adenomatous polyposis coli

AA Sequence

MGPLPAPSCTQRITWKGLLLTASLLNFWNPPTTAEVTIEAQPPKVSEGKDVLLLVHNLPQNLPGYFWYKG      1 - 70
EMTDLYHYIISYIVDGKIIIYGPAYSGRETVYSNASLLIQNVTRKDAGTYTLHIIKRGDETREEIRHFTF     71 - 140
TLYLETPKPYISSSNLNPREAMEAVRLICDPETLDASYLWWMNGQSLPVTHRLQLSKTNRTLYLFGVTKY    141 - 210
IAGPYECEIRNPVSASRSDPVTLNLLPKLPIPYITINNLNPRENKDVLAFTCEPKSENYTYIWWLNGQSL    211 - 280
PVSPGVKRPIENRILILPSVTRNETGPYQCEIRDRYGGLRSNPVILNVLYGPDLPRIYPSFTYYRSGENL    281 - 350
DLSCFTESNPPAEYFWTINGKFQQSGQKLFIPQITRNHSGLYACSVHNSATGKEISKSMTVKVSGPCHGD    351 - 420
LTESQS                                                                    421 - 426
//

Text Mined References (18)

PMID Year Title
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15982419 2005 Differential gene expression profile reveals deregulation of pregnancy specific beta1 glycoprotein 9 early during colorectal carcinogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7851895 1994 Gene organization of the pregnancy-specific glycoprotein region on human chromosome 19: assembly and analysis of a 700-kb cosmid contig spanning the region.
7806221 1994 Characterization of the PSG11 gene.
7794280 1995 Characterization of cDNA encoding novel pregnancy-specific glycoprotein variants.
More...