Property Summary

NCBI Gene PubMed Count 18
PubMed Score 40.32
PubTator Score 16.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Lymphangitis 6 3.138 1.6

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.400 1.1e-03
atypical teratoid / rhabdoid tumor 1.200 3.2e-03
Breast cancer -1.200 2.2e-02
cystic fibrosis 1.101 2.5e-04
glioblastoma 1.200 5.7e-03
malignant mesothelioma 3.900 1.2e-09
medulloblastoma, large-cell 1.700 4.2e-05
osteosarcoma 1.467 8.4e-06
ovarian cancer 1.300 2.5e-12
psoriasis 1.300 9.1e-06

Gene RIF (2)

AA Sequence

MGPLPAPSCTQRITWKGLLLTASLLNFWNPPTTAEVTIEAQPPKVSEGKDVLLLVHNLPQNLPGYFWYKG      1 - 70
EMTDLYHYIISYIVDGKIIIYGPAYSGRETVYSNASLLIQNVTRKDAGTYTLHIIKRGDETREEIRHFTF     71 - 140
TLYLETPKPYISSSNLNPREAMEAVRLICDPETLDASYLWWMNGQSLPVTHRLQLSKTNRTLYLFGVTKY    141 - 210
IAGPYECEIRNPVSASRSDPVTLNLLPKLPIPYITINNLNPRENKDVLAFTCEPKSENYTYIWWLNGQSL    211 - 280
PVSPGVKRPIENRILILPSVTRNETGPYQCEIRDRYGGLRSNPVILNVLYGPDLPRIYPSFTYYRSGENL    281 - 350
DLSCFTESNPPAEYFWTINGKFQQSGQKLFIPQITRNHSGLYACSVHNSATGKEISKSMTVKVSGPCHGD    351 - 420
LTESQS                                                                    421 - 426
//

Text Mined References (19)

PMID Year Title