Property Summary

NCBI Gene PubMed Count 31
PubMed Score 20.62
PubTator Score 40.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

 GO Function (1)

Gene RIF (10)

AA Sequence

MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVR      1 - 70
LIQFEKVTEEPMGITLKLNEKQSCTVARILHGGMIHRQGSLHVGDEILEINGTNVTNHSVDQLQKAMKET     71 - 140
KGMISLKVIPNQQSRLPALQMFMRAQFDYDPKKDNLIPCKEAGLKFATGDIIQIINKDDSNWWQGRVEGS    141 - 210
SKESAGLIPSPELQEWRVASMAQSAPSEAPSCSPFGKKKKYKDKYLAKHSSIFDQLDVVSYEEVVRLPAF    211 - 280
KRKTLVLIGASGVGRSHIKNALLSQNPEKFVYPVPYTTRPPRKSEEDGKEYHFISTEEMTRNISANEFLE    281 - 350
FGSYQGNMFGTKFETVHQIHKQNKIAILDIEPQTLKIVRTAELSPFIVFIAPTDQGTQTEALQQLQKDSE    351 - 420
AIRSQYAHYFDLSLVNNGVDETLKKLQEAFDQACSSPQWVPVSWVY                            421 - 466
//

Text Mined References (37)

PMID Year Title