Property Summary

NCBI Gene PubMed Count 28
PubMed Score 20.62
PubTator Score 40.03

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q00013 B4DZV5 G3XAI1 Q2TSB6 Q5J7V5 p55
Symbols MRG1
PEMP
AAG12
EMP55
DXS552E

Gene

PDB

2EJY   2EV8   3NEY  

Gene RIF (8)

PMID Text
25408337 Studies indicate that palmitoylated erythrocyte membrane protein p55 (MPP1) and its palmitoylation play a crucial role in lateral membrane organization in erythroid cells.
23507198 MPP1 knockdown significantly affects the activation of MAP-kinase signaling.
22496366 pathophysiological relationship between the loss of MPP1-directed palmitoylation activity and perturbed lateral membrane organization.
21509594 MPP1 gene expression is decreased in both classic and follicular variants of papillary thyroid carcinoma.
19144871 p55-NF2 protein interaction may play a functional role in the regulation of apico-basal polarity and tumor suppression pathways in non-erythroid cells.
18952129 p55 binds to two distinct sites within the FERM domain, and the alternatively spliced exon 5 is necessary for the membrane targeting of protein 4.1R in epithelial cells.
17584769 MPP1 links the Usher protein network and the Crumbs protein complex in the retina
16741958 Results show the NMR-derived structure of the human erythroid p55 PDZ domain and propose a possible interaction mode with the C-terminus of glycophorin C.

AA Sequence

MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVR      1 - 70
LIQFEKVTEEPMGITLKLNEKQSCTVARILHGGMIHRQGSLHVGDEILEINGTNVTNHSVDQLQKAMKET     71 - 140
KGMISLKVIPNQQSRLPALQMFMRAQFDYDPKKDNLIPCKEAGLKFATGDIIQIINKDDSNWWQGRVEGS    141 - 210
SKESAGLIPSPELQEWRVASMAQSAPSEAPSCSPFGKKKKYKDKYLAKHSSIFDQLDVVSYEEVVRLPAF    211 - 280
KRKTLVLIGASGVGRSHIKNALLSQNPEKFVYPVPYTTRPPRKSEEDGKEYHFISTEEMTRNISANEFLE    281 - 350
FGSYQGNMFGTKFETVHQIHKQNKIAILDIEPQTLKIVRTAELSPFIVFIAPTDQGTQTEALQQLQKDSE    351 - 420
AIRSQYAHYFDLSLVNNGVDETLKKLQEAFDQACSSPQWVPVSWVY                            421 - 466
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25408337 2015 Membrane rafts in the erythrocyte membrane: a novel role of MPP1p55.
23507198 2013 The role of MPP1/p55 and its palmitoylation in resting state raft organization in HEL cells.
23446634 2013 Genome-wide association analysis of red blood cell traits in African Americans: the COGENT Network.
23263863 2013 GWAS of blood cell traits identifies novel associated loci and epistatic interactions in Caucasian and African-American children.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22496366 2012 Palmitoylation of MPP1 (membrane-palmitoylated protein 1)/p55 is crucial for lateral membrane organization in erythroid cells.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21509594 2011 Differential expression of a set of genes in follicular and classic variants of papillary thyroid carcinoma.
More...