Property Summary

NCBI Gene PubMed Count 26
PubMed Score 93.55
PubTator Score 20.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma -1.700 1.6e-07
esophageal adenocarcinoma -1.400 3.6e-02
glioblastoma 2.000 5.5e-04
osteosarcoma -2.508 5.7e-04
adrenocortical carcinoma -1.268 4.7e-03
tuberculosis 2.800 3.0e-09
pancreatic ductal adenocarcinoma liver m... -1.471 7.6e-03
intraductal papillary-mucinous adenoma (... -1.500 2.2e-03
lung cancer 1.300 1.3e-02
breast carcinoma -1.400 5.9e-03
fibroadenoma -2.100 2.8e-02
interstitial cystitis -2.000 5.8e-04
pediatric high grade glioma 1.700 4.5e-05
group 4 medulloblastoma -1.100 3.6e-03
pilocytic astrocytoma 3.100 7.1e-11
posterior fossa group A ependymoma 1.400 3.8e-06
lung carcinoma -2.500 1.5e-39
ductal carcinoma in situ -2.300 1.3e-03
invasive ductal carcinoma -2.600 7.2e-03
ovarian cancer -2.600 1.8e-08
pituitary cancer -1.200 3.1e-05
psoriasis 1.300 2.8e-130

Protein-protein Interaction (2)

Gene RIF (6)

PMID Text
23125841 Tandem affinity purification and mass spectrometry analysis identify glycogen phosphorylase of liver (PYGL), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
20800603 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17705025 Deficiency of liver glycogen phosphorylase is predominantly the result of missense mutations affecting enzyme activity. There are no common mutations and the severity of clinical symptoms varies significantly.
15223230 Observational study of genotype prevalence. (HuGE Navigator)
15223230 Susceptibility to excessive liver glycogen storage in patients with type 1 diabetes.

AA Sequence

MAKPLTDQEKRRQISIRGIVGVENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIR      1 - 70
TQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRL     71 - 140
AACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHT    141 - 210
NTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPNDFNLRDFNVGDYIQAVLDRNLAENISRVL    211 - 280
YPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKASKFGSTRGAGTVFDAFPDQVAIQLNDTHPALAIPEL    281 - 350
MRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFP    351 - 420
KDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPR    421 - 490
RWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINP    491 - 560
SSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADV    561 - 630
VNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEM    631 - 700
AEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHD    701 - 770
RFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSDLKISLSNE    771 - 840
SNKVNGN                                                                   841 - 847
//

Text Mined References (31)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24132900 2013 Genome-wide association study of atypical psychosis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23007406 2012 Genome-wide association study identifies germline polymorphisms associated with relapse of childhood acute lymphoblastic leukemia.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22225877 2012 Acetylation negatively regulates glycogen phosphorylase by recruiting protein phosphatase 1.
21269460 2011 Initial characterization of the human central proteome.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17705025 2007 High frequency of missense mutations in glycogen storage disease type VI.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15223230 2004 Intermittent and recurrent hepatomegaly due to glycogen storage in a patient with type 1 diabetes: genetic analysis of the liver glycogen phosphorylase gene (PYGL).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14684825 2003 Genome-wide survey of human alternative pre-mRNA splicing with exon junction microarrays.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12204691 2002 Structure-activity analysis of the purine binding site of human liver glycogen phosphorylase.
11093832 2000 Activation of the liver glycogen phosphorylase by Ca(2+)oscillations: a theoretical study.
10980448 2000 Human liver glycogen phosphorylase inhibitors bind at a new allosteric site.
10949035 2000 Activation of human liver glycogen phosphorylase by alteration of the secondary structure and packing of the catalytic core.
9536091 1998 Identification of a mutation in liver glycogen phosphorylase in glycogen storage disease type VI.
9529348 1998 Mutations in the liver glycogen phosphorylase gene (PYGL) underlying glycogenosis type VI.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
3509980 1987 McArdle's & Hers' diseases: glycogen phosphorylase transcriptional expression in human tissues.
2883891 1987 The polymorphic locus for glycogen storage disease VI (liver glycogen phosphorylase) maps to chromosome 14.
2877458 1986 Sequence analysis of the cDNA encoding human liver glycogen phosphorylase reveals tissue-specific codon usage.