Property Summary

Ligand Count 668
NCBI Gene PubMed Count 303
PubMed Score 1308.14
PubTator Score 863.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer -1.300 3.2e-03
ovarian cancer 1.200 2.9e-05

Protein-protein Interaction (1)

PDB (145)

Gene RIF (213)

AA Sequence

MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINAS      1 - 70
LIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNL     71 - 140
KLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGP    141 - 210
VVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKF    211 - 280
IMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEK    281 - 350
GSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLT    351 - 420
AGAYLCYRFLFNSNT                                                           421 - 435
//

Text Mined References (308)

PMID Year Title