Property Summary

NCBI Gene PubMed Count 13
PubMed Score 22.96
PubTator Score 12.52

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.400 1.3e-02
tuberculosis and treatment for 3 months 1.100 5.2e-06

Gene RIF (3)

AA Sequence

MAATALLEAGLARVLFYPTLLYTLFRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVIT      1 - 70
MNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSA     71 - 140
TMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT             141 - 201
//

Text Mined References (17)

PMID Year Title