Property Summary

Ligand Count 51
NCBI Gene PubMed Count 97
PubMed Score 183.72
PubTator Score 107.85

Knowledge Summary

Patent (16,143)

Expression

  Differential Expression (13)

Disease log2 FC p
cystic fibrosis -1.500 1.5e-04
ductal carcinoma in situ 1.500 6.6e-03
interstitial cystitis -1.600 4.7e-03
intraductal papillary-mucinous adenoma (... 2.100 9.5e-04
intraductal papillary-mucinous carcinoma... 2.200 1.6e-03
intraductal papillary-mucinous neoplasm ... 1.100 1.0e-02
invasive ductal carcinoma 1.200 3.0e-03
lung adenocarcinoma 1.600 2.4e-09
nasopharyngeal carcinoma -1.100 1.8e-06
osteosarcoma 1.422 1.9e-06
ovarian cancer 1.400 4.2e-09
pancreatic cancer 2.500 3.1e-08
spina bifida -1.507 4.6e-02

 GWAS Trait (2)

Protein-protein Interaction (4)

Gene RIF (70)

AA Sequence

MVSRDQAHLGPKYVGLWDFKSRTDEELSFRAGDVFHVARKEEQWWWATLLDEAGGAVAQGYVPHNYLAER      1 - 70
ETVESEPWFFGCISRSEAVRRLQAEGNATGAFLIRVSEKPSADYVLSVRDTQAVRHYKIWRRAGGRLHLN     71 - 140
EAVSFLSLPELVNYHRAQSLSHGLRLAAPCRKHEPEPLPHWDDWERPREEFTLCRKLGSGYFGEVFEGLW    141 - 210
KDRVQVAIKVISRDNLLHQQMLQSEIQAMKKLRHKHILALYAVVSVGDPVYIITELMAKGSLLELLRDSD    211 - 280
EKVLPVSELLDIAWQVAEGMCYLESQNYIHRDLAARNILVGENTLCKVGDFGLARLIKEDVYLSHDHNIP    281 - 350
YKWTAPEALSRGHYSTKSDVWSFGILLHEMFSRGQVPYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLM    351 - 420
LTCWCRDPEQRPCFKALRERLSSFTSYENPT                                           421 - 451
//

Text Mined References (105)

PMID Year Title