Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.00
PubTator Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 3.38311079731967E-7

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.300 0.000

Synonym

Accession Q86Y79 PTH
Symbols PTH1
C9orf115

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Xenopus OMA EggNOG
S.cerevisiae OMA Inparanoid

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
14660562 arrangement of secondary structure elements generates a fold not previously reported for peptidyl-trna hydrolase and intermolecular contacts in the crystal asymmetric unit cell suggest a likely surface for protein-protein interactions

AA Sequence

MRPGGFLGAGQRLSRAMSRCVLEPRPPGKRWMVAGLGNPGLPGTRHSVGMAVLGQLARRLGVAESWTRDR      1 - 70
HCAADLALAPLGDAQLVLLRPRRLMNANGRSVARAAELFGLTAEEVYLVHDELDKPLGRLALKLGGSARG     71 - 140
HNGVRSCISCLNSNAMPRLRVGIGRPAHPEAVQAHVLGCFSPAEQELLPLLLDRATDLILDHIRERSQGP    141 - 210
SLGP                                                                      211 - 214
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18482256 2009 Protein microarray analysis identifies human cellular prion protein interactors.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14660562 2004 Crystal structure of a human peptidyl-tRNA hydrolase reveals a new fold and suggests basis for a bifunctional activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.