Property Summary

NCBI Gene PubMed Count 279
PubMed Score 21156.59
PubTator Score 13052.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

Gene RIF (240)

AA Sequence

MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGA      1 - 70
PLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ                              71 - 115
//

Text Mined References (281)

PMID Year Title