Property Summary

NCBI Gene PubMed Count 279
PubMed Score 21156.59
PubTator Score 13052.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

PDB (15)

Gene RIF (240)

AA Sequence

MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGA      1 - 70
PLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ                              71 - 115
//

Text Mined References (281)

PMID Year Title