Property Summary

NCBI Gene PubMed Count 67
PubMed Score 59.31
PubTator Score 278.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 3.1e-04
Multiple myeloma 1327 4.6e-04
lung cancer 4473 8.4e-03
Waldenstrons macroglobulinemia 764 1.7e-02
Disease Target Count Z-score Confidence
Eye disease 55 0.0 1.0

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.245 1.7e-02
Multiple myeloma 1.480 4.6e-04
lung cancer 1.300 8.4e-03
ovarian cancer -1.400 3.1e-04

Protein-protein Interaction (1)

Gene RIF (29)

PMID Text
26151834 Even if p23 predominantly binds the Hsp90 dimer, p23 is also able to interact with Hsp90 oligomers, shifting the Hsp90 dimer-oligomers equilibrium toward dimer.
25241147 increased p23 expression may allow cells to acquire a more aggressive phenotype, contributing to disease progression
23741051 FKBP4, p23, and Aha1 cooperatively regulate the progression of hAgo2 through the chaperone cycle.
23413029 p23 recruits PHD2 to the HSP90 machinery to facilitate HIF-1alpha hydroxylation
22899854 The effects of p23 on androgen receptor (AR) activity are at least partly HSP90 independent, a mutant form of p23, unable to bind HSP90, increases AR activity.
22759865 p23 co-chaperone protects the aryl hydrocarbon receptor from degradation
22677230 As an anti-apoptotic factor, p23 is able to be a potential target for anti-leukemic therapy.
22277657 In cytosol only one protein called p23 hsp90 binds to Bax but the binding protein does not affect the subcellular localization and pro-apoptotic activity of Bax.
22190034 HIV-1 Rev interacting protein, prostaglandin E synthase 3 (PTGES3), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
22174317 HIV-1 Rev interacting protein, prostaglandin E synthase 3 (PTGES3), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
22074947 a small increase in the expression of p23 amplifies ER-binding genome wide and, in combination with ER, elicits an invasive phenotype in breast cancer
21853119 The p23 cochaperone of Hsp90, which plays a major role in glucocorticoid receptor folding and function, associates with influenza virus polymerase.
21691801 Patients with severe Alzheimer disease displayed a consistent reduction in brain p23 levels. Cleavage product p19 was not seen in AD brain samples.
21183720 the N-terminal domain of human Hsp90 triggers binding to the cochaperone p23
20847343 High levels of Hsp90 cochaperone p23 promote tumor progression in breast cancer by increasing lymph node metastases and drug resistance.
19996313 Data show that the small molecule celastrol inhibits the Hsp90 chaperoning machinery by inactivating the co-chaperone p23, resulting in a more selective destabilization of steroid receptors.
19751963 the interaction of the Hsp90-p23 complex with hTERT is critical for regulation of the nuclear localization of telomerase
19740745 Overexpression of Delta p23 resulted in a decrease in hTERT levels, and a down-regulation in telomerase activity.
19347995 all three terminal prostaglandin synthases, mPGES-1, mPGES-2, and cPGES, are over-expressed in human gliomas
19254810 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19001348 Data show that cytosolic prostaglandin E synthase 2 is found in microglia, neurons, and endothelium of control human middle frontal gyrus and that its levels decrease in pyramidal cells of Alzheimer's disease brains.
18854154 Knockdown of prostaglandin E synthase 3 (PTGES3) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
17697149 Carbonyl reductase-1 (CBR1), microsomal prostaglandin E synthase-1 and 2 (mPGES-1, mPGES-2), cytosolic prostaglandin E synthase (cPGES), aldoketoreductase (AKR1C1) and prostaglandin F synthase (AKR1C3) were all expressed in hair follicles.
16809759 p23 differentially regulates ER target genes and is involved in the control of distinct cellular processes in breast tumor development
16403413 A role proposed for co-chaperone p23 is to lock individual subunits of Hsp90 in an ATP-dependent conformational state that has a high affinity for client proteins.
14507910 acts in vivo to stabilize hsp90 binding to client protein [hsp90 cochaperone p23]
12135483 TEP1, hTR, hsp90, p23, and dyskerin remained at high and unchanged levels throughout up- or down regulation of telomerase activity.
12077419 localizes in vivo to genomic response elements in a hormone-dependent manner, disrupting receptor-mediated transcriptional activation in vivo and in vitro
11531413 HIV-1 Rev interacting protein, prostaglandin E synthase 3 (PTGES3), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells

AA Sequence

MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTD      1 - 70
RSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPE     71 - 140
VDGADDDSQDSDDEKMPDLE                                                      141 - 160
//

Text Mined References (86)

PMID Year Title
27353360 2016 The FNIP co-chaperones decelerate the Hsp90 chaperone cycle and enhance drug binding.
26151834 2015 Hsp90 oligomerization process: How can p23 drive the chaperone machineries?
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25241147 2015 The co-chaperone p23 promotes prostate cancer motility and metastasis.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24711448 2014 Defective Tibetan PHD2 binding to p23 links high altitude adaption to altered oxygen sensing.
24345775 2013 Dysregulation of glucocorticoid receptor co-factors FKBP5, BAG1 and PTGES3 in prefrontal cortex in psychotic illness.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23741051 2013 Hsp90 cochaperones p23 and FKBP4 physically interact with hAgo2 and activate RNA interference-mediated silencing in mammalian cells.
23413029 2013 Prolyl hydroxylase domain protein 2 (PHD2) binds a Pro-Xaa-Leu-Glu motif, linking it to the heat shock protein 90 pathway.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22899854 2012 Role of the HSP90-associated cochaperone p23 in enhancing activity of the androgen receptor and significance for prostate cancer.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22759865 2012 p23 co-chaperone protects the aryl hydrocarbon receptor from degradation in mouse and human cell lines.
22677230 2012 miRNA mediated up-regulation of cochaperone p23 acts as an anti-apoptotic factor in childhood acute lymphoblastic leukemia.
22277657 2012 Cytosolic Bax: does it require binding proteins to keep its pro-apoptotic activity in check?
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
22074947 2012 Research resource: enhanced genome-wide occupancy of estrogen receptor ? by the cochaperone p23 in breast cancer cells.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21853119 2011 Influenza virus infection induces the nuclear relocalization of the Hsp90 co-chaperone p23 and inhibits the glucocorticoid receptor response.
21691801 2012 The small chaperone protein p23 and its cleaved product p19 in cellular stress.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21183720 2011 N-terminal domain of human Hsp90 triggers binding to the cochaperone p23.
20847343 2010 High levels of Hsp90 cochaperone p23 promote tumor progression and poor prognosis in breast cancer by increasing lymph node metastases and drug resistance.
20385819 2010 Genetic variants near TIMP3 and high-density lipoprotein-associated loci influence susceptibility to age-related macular degeneration.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19996313 2010 Celastrol inhibits Hsp90 chaperoning of steroid receptors by inducing fibrillization of the Co-chaperone p23.
19875381 2010 A proteomic investigation of ligand-dependent HSP90 complexes reveals CHORDC1 as a novel ADP-dependent HSP90-interacting protein.
19751963 2010 Curcumin inhibits nuclear localization of telomerase by dissociating the Hsp90 co-chaperone p23 from hTERT.
19740745 2009 A truncated form of p23 down-regulates telomerase activity via disruption of Hsp90 function.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
19347995 2009 The terminal prostaglandin synthases mPGES-1, mPGES-2, and cPGES are all overexpressed in human gliomas.
19254810 2009 The glucocorticoid receptor heterocomplex gene STIP1 is associated with improved lung function in asthmatic subjects treated with inhaled corticosteroids.
19001348 Cytosolic prostaglandin E synthase: expression patterns in control and Alzheimer's disease brains.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18088087 2008 Phosphoproteome of resting human platelets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17697149 2007 Prostaglandin metabolism in human hair follicle.
17487921 2007 Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16809759 2006 The cochaperone p23 differentially regulates estrogen receptor target genes and promotes tumor cell adhesion and invasion.
16807684 2006 Phosphoproteomic analysis of the human pituitary.
16541075 2006 The finished DNA sequence of human chromosome 12.
16403413 2006 The co-chaperone p23 arrests the Hsp90 ATPase cycle to trap client proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14507910 2003 The hsp90 cochaperone p23 is the limiting component of the multiprotein hsp90/hsp70-based chaperone system in vivo where it acts to stabilize the client protein: hsp90 complex.
12853476 2003 Cofactor Tpr2 combines two TPR domains and a J domain to regulate the Hsp70/Hsp90 chaperone system.
12519887 2003 Expression and localization of prostaglandin E synthase isoforms in human fetal membranes in term and preterm labor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12135483 2002 Differential regulation of telomerase activity by six telomerase subunits.
12077419 2002 Disassembly of transcriptional regulatory complexes by molecular chaperones.
11879970 2002 The p23 co-chaperone facilitates dioxin receptor signaling in a yeast model system.
11847219 2002 Up-regulation of prostaglandin E2 synthesis by interleukin-1beta in human orbital fibroblasts involves coordinate induction of prostaglandin-endoperoxide H synthase-2 and glutathione-dependent prostaglandin E2 synthase expression.
11812147 2002 Stimulation of the weak ATPase activity of human hsp90 by a client protein.
11809754 2002 HSP40 binding is the first step in the HSP90 chaperoning pathway for the progesterone receptor.
11597177 2001 Identification and initial characterization of 5000 expressed sequenced tags (ESTs) each from adult human normal and osteoarthritic cartilage cDNA libraries.
11447118 2001 The Hsp90 chaperone complex is both a facilitator and a repressor of the dsRNA-dependent kinase PKR.
11274138 2001 Stable association of hsp90 and p23, but Not hsp70, with active human telomerase.
11259606 2001 The hsp90 chaperone complex regulates intracellular localization of the dioxin receptor.
11013261 2000 The immunophilin-like protein XAP2 regulates ubiquitination and subcellular localization of the dioxin receptor.
10922363 2000 Molecular identification of cytosolic prostaglandin E2 synthase that is functionally coupled with cyclooxygenase-1 in immediate prostaglandin E2 biosynthesis.
10811660 2000 Crystal structure and activity of human p23, a heat shock protein 90 co-chaperone.
10691735 2000 The p23 molecular chaperones act at a late step in intracellular receptor action to differentially affect ligand efficacies.
10207098 1999 Role for Hsp90-associated cochaperone p23 in estrogen receptor signal transduction.
10095121 1999 Interaction of the p23/p198 protein with ErbB-3.
9817749 1998 In vivo function of Hsp90 is dependent on ATP binding and ATP hydrolysis.
9727490 1998 Repression of heat shock transcription factor HSF1 activation by HSP90 (HSP90 complex) that forms a stress-sensitive complex with HSF1.
9261129 1997 Folding of the glucocorticoid receptor by the heat shock protein (hsp) 90-based chaperone machinery. The role of p23 is to stabilize receptor.hsp90 heterocomplexes formed by hsp90.p60.hsp70.
9148915 1997 Folding of the glucocorticoid receptor by the reconstituted Hsp90-based chaperone machinery. The initial hsp90.p60.hsp70-dependent step is sufficient for creating the steroid binding conformation.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8114727 1994 Characterization of a novel 23-kilodalton protein of unactive progesterone receptor complexes.