Property Summary

NCBI Gene PubMed Count 33
PubMed Score 33.31
PubTator Score 20.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Thyroid Neoplasm 33
Disease Target Count P-value
psoriasis 6685 8.7e-05
Disease Target Count Z-score Confidence
Bladder transitional cell papilloma 4 3.269 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.600 8.7e-05

Gene RIF (21)

PMID Text
24467603 Four single nucleotide polymorphisms in two genes in the PGE2 family, PTGES2 and PTGER4, were significantly associated with primary graft dysfunction after lung transplantation.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19664621 high immunoreactivity of mPGES-2 in pyramidal neurons of AD brains indicates that it might have a potential role in the functional replacement of cytosolic PGES or inactive mPGES-1 in later stages of Alzheimer disease
19412621 These results indicate that mPGES-1 and mPGES-2 may each play a role in colorectal cancer progression.
19371221 A marginal but significant influence of the PTGES2 298H single nucleotide polymorphism on BMI was found in a large population-based study.
19371221 Observational study of gene-disease association. (HuGE Navigator)
19347995 all three terminal prostaglandin synthases, mPGES-1, mPGES-2, and cPGES, are over-expressed in human gliomas
19336370 Observational study of gene-disease association. (HuGE Navigator)
19268562 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17979097 risk-reducing effects of the minor His allele of the prostaglandin E synthase 2 (PTGES2) Arg298His polymorphism could be mediated partly by lowered body mass index (BMI)
17979097 Observational study of gene-disease association. (HuGE Navigator)
17697149 Carbonyl reductase-1 (CBR1), microsomal prostaglandin E synthase-1 and 2 (mPGES-1, mPGES-2), cytosolic prostaglandin E synthase (cPGES), aldoketoreductase (AKR1C1) and prostaglandin F synthase (AKR1C3) were all expressed in hair follicles.
17566096 Observational study of gene-disease association. (HuGE Navigator)
17566096 study obtained evidence from two Caucasian study populations that the His298-allele of PTGES2 Arg298His confers to reduced risk of type 2 diabetes
17266179 Observational study of gene-disease association. (HuGE Navigator)
16714329 alphaTOS inhibits COX activity, thereby inhibiting PGE2 production in human lung epithelial cells
15879117 Transactivators GBF1 and CCAAT/enhancer-binding protein-beta physically interact to induce interferon-gamma-regulated transcription; a 37-aa long peptide derived from the GBF1 protein can associate with C/EBP-beta in an IFN-inducible manner.
12804604 110Cys is essential in the active site of membrane-associated prostaglandin E synthase-2
12050152 role in regulating interferon-gamma-dependent gene expression
11847219 Up-regulation of prostaglandin E2 synthesis by interleukin-1beta in human orbital fibroblasts involves coordinate induction of prostaglandin-endoperoxide H synthase-2 and glutathione-dependent prostaglandin E2 synthase expression

AA Sequence

MDPAARVVRALWPGGCALAWRLGGRPQPLLPTQSRAGFAGAAGGPSPVAAARKGSPRLLGAAALALGGAL      1 - 70
GLYHTARWHLRAQDLHAERSAAQLSLSSRLQLTLYQYKTCPFCSKVRAFLDFHALPYQVVEVNPVRRAEI     71 - 140
KFSSYRKVPILVAQEGESSQQLNDSSVIISALKTYLVSGQPLEEIITYYPAMKAVNEQGKEVTEFGNKYW    141 - 210
LMLNEKEAQQVYGGKEARTEEMKWRQWADDWLVHLISPNVYRTPTEALASFDYIVREGKFGAVEGAVAKY    211 - 280
MGAAAMYLISKRLKSRHRLQDNVREDLYEAADKWVAAVGKDRPFMGGQKPNLADLAVYGVLRVMEGLDAF    281 - 350
DDLMQHTHIQPWYLRVERAITEASPAH                                               351 - 377
//

Text Mined References (38)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24467603 2014 Genetic variation in the prostaglandin E2 pathway is associated with primary graft dysfunction.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
19664621 2010 Microsomal prostaglandin E synthase-2: cellular distribution and expression in Alzheimer's disease.
19412621 2009 Microsomal prostaglandin E synthase protein levels correlate with prognosis in colorectal cancer patients.
19371221 2009 Association analysis between the prostaglandin E synthase 2 R298H polymorphism and body mass index in 8079 participants of the KORA study cohort.
19347995 2009 The terminal prostaglandin synthases mPGES-1, mPGES-2, and cPGES are all overexpressed in human gliomas.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19268562 2009 Influence of a type 2 diabetes associated prostaglandin E synthase 2 polymorphism on blood prostaglandin E2 levels.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
18198127 2008 Studies on membrane-associated prostaglandin E synthase-2 with reference to production of 12L-hydroxy-5,8,10-heptadecatrienoic acid (HHT).
17979097 2007 Prostaglandin E synthase 2 (PTGES2) Arg298His polymorphism and parameters of the metabolic syndrome.
17697149 2007 Prostaglandin metabolism in human hair follicle.
17566096 2007 Association of prostaglandin E synthase 2 (PTGES2) Arg298His polymorphism with type 2 diabetes in two German study populations.
17266179 2007 Candidate gene association study of type 2 diabetes in a nested case-control study of the EPIC-Potsdam cohort - role of fat assimilation.
16714329 2006 Alpha-tocopheryl succinate, in contrast to alpha-tocopherol and alpha-tocopheryl acetate, inhibits prostaglandin E2 production in human lung epithelial cells.
16381901 2006 The LIFEdb database in 2006.
16341674 2005 Transcriptome analysis of human gastric cancer.
15879117 2005 IFN-gamma-stimulated transcriptional activation by IFN-gamma-activated transcriptional element-binding factor 1 occurs via an inducible interaction with CAAAT/enhancer-binding protein-beta.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12835322 2003 Cellular prostaglandin E2 production by membrane-bound prostaglandin E synthase-2 via both cyclooxygenases-1 and -2.
12804604 2003 Essential 110Cys in active site of membrane-associated prostaglandin E synthase-2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12050152 2002 A novel transactivating factor that regulates interferon-gamma-dependent gene expression.
11866447 2002 Identification and characterization of a novel type of membrane-associated prostaglandin E synthase.
11847219 2002 Up-regulation of prostaglandin E2 synthesis by interleukin-1beta in human orbital fibroblasts involves coordinate induction of prostaglandin-endoperoxide H synthase-2 and glutathione-dependent prostaglandin E2 synthase expression.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076863 2000 DNA cloning using in vitro site-specific recombination.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.