Property Summary

Ligand Count 21
NCBI Gene PubMed Count 33
PubMed Score 34.91
PubTator Score 20.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Thyroid Neoplasms 34 0.0 0.0
Disease Target Count
Thyroid Neoplasm 37
Disease Target Count P-value
psoriasis 6694 8.7e-05
Disease Target Count Z-score Confidence
Bladder transitional cell papilloma 5 3.273 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.600 8.7e-05

Gene RIF (21)

AA Sequence

MDPAARVVRALWPGGCALAWRLGGRPQPLLPTQSRAGFAGAAGGPSPVAAARKGSPRLLGAAALALGGAL      1 - 70
GLYHTARWHLRAQDLHAERSAAQLSLSSRLQLTLYQYKTCPFCSKVRAFLDFHALPYQVVEVNPVRRAEI     71 - 140
KFSSYRKVPILVAQEGESSQQLNDSSVIISALKTYLVSGQPLEEIITYYPAMKAVNEQGKEVTEFGNKYW    141 - 210
LMLNEKEAQQVYGGKEARTEEMKWRQWADDWLVHLISPNVYRTPTEALASFDYIVREGKFGAVEGAVAKY    211 - 280
MGAAAMYLISKRLKSRHRLQDNVREDLYEAADKWVAAVGKDRPFMGGQKPNLADLAVYGVLRVMEGLDAF    281 - 350
DDLMQHTHIQPWYLRVERAITEASPAH                                               351 - 377
//

Text Mined References (38)

PMID Year Title